qt5-doc 5.12.2-1 File List

Package has 17681 files and 645 directories.

Back to Package

  • usr/
  • usr/share/
  • usr/share/doc/
  • usr/share/doc/qt/
  • usr/share/doc/qt/activeqt.qch
  • usr/share/doc/qt/activeqt/
  • usr/share/doc/qt/activeqt/activeqt-activeqt-comapp-comapp-pro.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-comapp-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-comapp-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-hierarchy-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-hierarchy-hierarchy-pro.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-hierarchy-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-hierarchy-objects-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-hierarchy-objects-h.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-mediaplayer-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-mediaplayer-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-mediaplayer-mainwindow-ui.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-mediaplayer-mediaaxwidget-h.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-mediaplayer-mediaplayer-pro.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-menus-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-menus-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-menus-menus-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-menus-menus-h.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-menus-menus-pro.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-multiple-ax1-h.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-multiple-ax2-h.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-multiple-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-multiple-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-multiple-multiple-pro.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-opengl-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-opengl-glbox-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-opengl-glbox-h.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-opengl-globjwin-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-opengl-globjwin-h.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-opengl-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-opengl-opengl-pro.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-qutlook-addressview-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-qutlook-addressview-h.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-qutlook-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-qutlook-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-qutlook-qutlook-pro.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-simple-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-simple-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-simple-simple-pro.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-wrapper-example.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-wrapper-main-cpp.html
  • usr/share/doc/qt/activeqt/activeqt-activeqt-wrapper-wrapper-pro.html
  • usr/share/doc/qt/activeqt/activeqt-container.html
  • usr/share/doc/qt/activeqt/activeqt-dotnet.html
  • usr/share/doc/qt/activeqt/activeqt-dumpcpp.html
  • usr/share/doc/qt/activeqt/activeqt-dumpdoc.html
  • usr/share/doc/qt/activeqt/activeqt-index.html
  • usr/share/doc/qt/activeqt/activeqt-server.html
  • usr/share/doc/qt/activeqt/activeqt-tools.html
  • usr/share/doc/qt/activeqt/activeqt.index
  • usr/share/doc/qt/activeqt/activeqt.qhp
  • usr/share/doc/qt/activeqt/activeqt.qhp.sha1
  • usr/share/doc/qt/activeqt/activeqt.tags
  • usr/share/doc/qt/activeqt/examples-manifest.xml
  • usr/share/doc/qt/activeqt/images/
  • usr/share/doc/qt/activeqt/images/activeqt-mediaplayer-example.jpg
  • usr/share/doc/qt/activeqt/images/arrow_bc.png
  • usr/share/doc/qt/activeqt/images/bgrContent.png
  • usr/share/doc/qt/activeqt/images/btn_next.png
  • usr/share/doc/qt/activeqt/images/btn_prev.png
  • usr/share/doc/qt/activeqt/images/bullet_dn.png
  • usr/share/doc/qt/activeqt/images/bullet_sq.png
  • usr/share/doc/qt/activeqt/images/home.png
  • usr/share/doc/qt/activeqt/images/ico_note.png
  • usr/share/doc/qt/activeqt/images/ico_note_attention.png
  • usr/share/doc/qt/activeqt/images/ico_out.png
  • usr/share/doc/qt/activeqt/images/logo.png
  • usr/share/doc/qt/activeqt/qaxaggregated-members.html
  • usr/share/doc/qt/activeqt/qaxaggregated.html
  • usr/share/doc/qt/activeqt/qaxbindable-members.html
  • usr/share/doc/qt/activeqt/qaxbindable.html
  • usr/share/doc/qt/activeqt/qaxcontainer-module.html
  • usr/share/doc/qt/activeqt/qaxfactory-members.html
  • usr/share/doc/qt/activeqt/qaxfactory-obsolete.html
  • usr/share/doc/qt/activeqt/qaxfactory.html
  • usr/share/doc/qt/activeqt/qaxobject-members.html
  • usr/share/doc/qt/activeqt/qaxobject-obsolete.html
  • usr/share/doc/qt/activeqt/qaxobject.html
  • usr/share/doc/qt/activeqt/qaxscript-members.html
  • usr/share/doc/qt/activeqt/qaxscript-obsolete.html
  • usr/share/doc/qt/activeqt/qaxscript.html
  • usr/share/doc/qt/activeqt/qaxscriptengine-members.html
  • usr/share/doc/qt/activeqt/qaxscriptengine.html
  • usr/share/doc/qt/activeqt/qaxscriptmanager-members.html
  • usr/share/doc/qt/activeqt/qaxscriptmanager-obsolete.html
  • usr/share/doc/qt/activeqt/qaxscriptmanager.html
  • usr/share/doc/qt/activeqt/qaxselect-members.html
  • usr/share/doc/qt/activeqt/qaxselect-obsolete.html
  • usr/share/doc/qt/activeqt/qaxselect.html
  • usr/share/doc/qt/activeqt/qaxserver-demo-hierarchy.html
  • usr/share/doc/qt/activeqt/qaxserver-demo-menus.html
  • usr/share/doc/qt/activeqt/qaxserver-demo-multiple.html
  • usr/share/doc/qt/activeqt/qaxserver-demo-opengl.html
  • usr/share/doc/qt/activeqt/qaxserver-demo-simple.html
  • usr/share/doc/qt/activeqt/qaxserver-demo-wrapper.html
  • usr/share/doc/qt/activeqt/qaxserver-module.html
  • usr/share/doc/qt/activeqt/qaxwidget-members.html
  • usr/share/doc/qt/activeqt/qaxwidget-obsolete.html
  • usr/share/doc/qt/activeqt/qaxwidget.html
  • usr/share/doc/qt/activeqt/style/
  • usr/share/doc/qt/activeqt/style/offline-simple.css
  • usr/share/doc/qt/activeqt/style/offline.css
  • usr/share/doc/qt/qdoc.qch
  • usr/share/doc/qt/qdoc/
  • usr/share/doc/qt/qdoc/01-qdoc-manual.html
  • usr/share/doc/qt/qdoc/03-qdoc-commands-markup.html
  • usr/share/doc/qt/qdoc/04-qdoc-commands-textmarkup.html
  • usr/share/doc/qt/qdoc/05-qdoc-commands-documentstructure.html
  • usr/share/doc/qt/qdoc/06-qdoc-commands-includecodeinline.html
  • usr/share/doc/qt/qdoc/07-0-qdoc-commands-includingexternalcode.html
  • usr/share/doc/qt/qdoc/08-qdoc-commands-creatinglinks.html
  • usr/share/doc/qt/qdoc/09-qdoc-commands-includingimages.html
  • usr/share/doc/qt/qdoc/10-qdoc-commands-tablesandlists.html
  • usr/share/doc/qt/qdoc/11-qdoc-commands-specialcontent.html
  • usr/share/doc/qt/qdoc/12-0-qdoc-commands-miscellaneous.html
  • usr/share/doc/qt/qdoc/13-qdoc-commands-topics.html
  • usr/share/doc/qt/qdoc/14-qdoc-commands-contextcommands.html
  • usr/share/doc/qt/qdoc/15-qdoc-commands-navigation.html
  • usr/share/doc/qt/qdoc/16-qdoc-commands-status.html
  • usr/share/doc/qt/qdoc/17-qdoc-commands-thread.html
  • usr/share/doc/qt/qdoc/18-qdoc-commands-relating.html
  • usr/share/doc/qt/qdoc/19-qdoc-commands-grouping.html
  • usr/share/doc/qt/qdoc/20-qdoc-commands-namingthings.html
  • usr/share/doc/qt/qdoc/21-0-qdoc-configuration.html
  • usr/share/doc/qt/qdoc/21-0-qdoc-creating-dita-maps.html
  • usr/share/doc/qt/qdoc/21-1-minimum-qdocconf.html
  • usr/share/doc/qt/qdoc/21-2-qtgui-qdocconf.html
  • usr/share/doc/qt/qdoc/21-3-qt-dita-xml-output.html
  • usr/share/doc/qt/qdoc/22-creating-help-project-files.html
  • usr/share/doc/qt/qdoc/22-qdoc-configuration-generalvariables.html
  • usr/share/doc/qt/qdoc/23-qdoc-configuration-cppvariables.html
  • usr/share/doc/qt/qdoc/24-qdoc-configuration-htmlvariables.html
  • usr/share/doc/qt/qdoc/25-qdoc-configuration-derivedprojects.html
  • usr/share/doc/qt/qdoc/26-qdoc-configuration-example-manifest-files.html
  • usr/share/doc/qt/qdoc/27-qdoc-commands-alphabetical.html
  • usr/share/doc/qt/qdoc/28-qdoc-qa-pages.html
  • usr/share/doc/qt/qdoc/corefeatures.html
  • usr/share/doc/qt/qdoc/images/
  • usr/share/doc/qt/qdoc/images/arrow_bc.png
  • usr/share/doc/qt/qdoc/images/bgrContent.png
  • usr/share/doc/qt/qdoc/images/btn_next.png
  • usr/share/doc/qt/qdoc/images/btn_prev.png
  • usr/share/doc/qt/qdoc/images/bullet_dn.png
  • usr/share/doc/qt/qdoc/images/bullet_sq.png
  • usr/share/doc/qt/qdoc/images/happy.gif
  • usr/share/doc/qt/qdoc/images/happyguy.jpg
  • usr/share/doc/qt/qdoc/images/home.png
  • usr/share/doc/qt/qdoc/images/ico_note.png
  • usr/share/doc/qt/qdoc/images/ico_note_attention.png
  • usr/share/doc/qt/qdoc/images/ico_out.png
  • usr/share/doc/qt/qdoc/images/link-to-qquickitem.png
  • usr/share/doc/qt/qdoc/images/links-to-links.png
  • usr/share/doc/qt/qdoc/images/logo.png
  • usr/share/doc/qt/qdoc/images/qa-table.png
  • usr/share/doc/qt/qdoc/images/training.jpg
  • usr/share/doc/qt/qdoc/images/windowsvista-pushbutton.png
  • usr/share/doc/qt/qdoc/qdoc-categories.html
  • usr/share/doc/qt/qdoc/qdoc-guide-clang.html
  • usr/share/doc/qt/qdoc/qdoc-guide-conf.html
  • usr/share/doc/qt/qdoc/qdoc-guide-writing.html
  • usr/share/doc/qt/qdoc/qdoc-guide.html
  • usr/share/doc/qt/qdoc/qdoc-index.html
  • usr/share/doc/qt/qdoc/qdoc-minimum-qdocconf.html
  • usr/share/doc/qt/qdoc/qdoc.index
  • usr/share/doc/qt/qdoc/qdoc.qhp
  • usr/share/doc/qt/qdoc/qdoc.qhp.sha1
  • usr/share/doc/qt/qdoc/qdoc.tags
  • usr/share/doc/qt/qdoc/qtgui-qdocconf.html
  • usr/share/doc/qt/qdoc/qtwritingstyle-cpp.html
  • usr/share/doc/qt/qdoc/qtwritingstyle-qml.html
  • usr/share/doc/qt/qdoc/style/
  • usr/share/doc/qt/qdoc/style/offline-simple.css
  • usr/share/doc/qt/qdoc/style/offline.css
  • usr/share/doc/qt/qmake.qch
  • usr/share/doc/qt/qmake/
  • usr/share/doc/qt/qmake/images/
  • usr/share/doc/qt/qmake/images/arrow_bc.png
  • usr/share/doc/qt/qmake/images/bgrContent.png
  • usr/share/doc/qt/qmake/images/btn_next.png
  • usr/share/doc/qt/qmake/images/btn_prev.png
  • usr/share/doc/qt/qmake/images/bullet_dn.png
  • usr/share/doc/qt/qmake/images/bullet_sq.png
  • usr/share/doc/qt/qmake/images/home.png
  • usr/share/doc/qt/qmake/images/ico_note.png
  • usr/share/doc/qt/qmake/images/ico_note_attention.png
  • usr/share/doc/qt/qmake/images/ico_out.png
  • usr/share/doc/qt/qmake/images/logo.png
  • usr/share/doc/qt/qmake/images/qmake-precompile-ui.png
  • usr/share/doc/qt/qmake/qmake-advanced-usage.html
  • usr/share/doc/qt/qmake/qmake-common-projects.html
  • usr/share/doc/qt/qmake/qmake-environment-reference.html
  • usr/share/doc/qt/qmake/qmake-function-reference.html
  • usr/share/doc/qt/qmake/qmake-language.html
  • usr/share/doc/qt/qmake/qmake-manual.html
  • usr/share/doc/qt/qmake/qmake-overview.html
  • usr/share/doc/qt/qmake/qmake-platform-notes.html
  • usr/share/doc/qt/qmake/qmake-precompiledheaders.html
  • usr/share/doc/qt/qmake/qmake-project-files.html
  • usr/share/doc/qt/qmake/qmake-reference.html
  • usr/share/doc/qt/qmake/qmake-running.html
  • usr/share/doc/qt/qmake/qmake-test-function-reference.html
  • usr/share/doc/qt/qmake/qmake-tutorial.html
  • usr/share/doc/qt/qmake/qmake-variable-reference.html
  • usr/share/doc/qt/qmake/qmake.index
  • usr/share/doc/qt/qmake/qmake.qhp
  • usr/share/doc/qt/qmake/qmake.qhp.sha1
  • usr/share/doc/qt/qmake/style/
  • usr/share/doc/qt/qmake/style/offline-simple.css
  • usr/share/doc/qt/qmake/style/offline.css
  • usr/share/doc/qt/qt3d.qch
  • usr/share/doc/qt/qt3d/
  • usr/share/doc/qt/qt3d/examples-manifest.xml
  • usr/share/doc/qt/qt3d/images/
  • usr/share/doc/qt/qt3d/images/Space-invaders.jpg
  • usr/share/doc/qt/qt3d/images/advanced-custom-material.jpg
  • usr/share/doc/qt/qt3d/images/arrow_bc.png
  • usr/share/doc/qt/qt3d/images/audio-visualizer-qml-example.png
  • usr/share/doc/qt/qt3d/images/basicshapes-cpp-example.jpg
  • usr/share/doc/qt/qt3d/images/bgrContent.png
  • usr/share/doc/qt/qt3d/images/btn_next.png
  • usr/share/doc/qt/qt3d/images/btn_prev.png
  • usr/share/doc/qt/qt3d/images/bullet_dn.png
  • usr/share/doc/qt/qt3d/images/bullet_sq.png
  • usr/share/doc/qt/qt3d/images/deferred-framegraph.png
  • usr/share/doc/qt/qt3d/images/ecs-1.png
  • usr/share/doc/qt/qt3d/images/ecs-2.png
  • usr/share/doc/qt/qt3d/images/framegraph-parallel-build.png
  • usr/share/doc/qt/qt3d/images/home.png
  • usr/share/doc/qt/qt3d/images/ico_note.png
  • usr/share/doc/qt/qt3d/images/ico_note_attention.png
  • usr/share/doc/qt/qt3d/images/ico_out.png
  • usr/share/doc/qt/qt3d/images/logo.png
  • usr/share/doc/qt/qt3d/images/multiviewport-1.png
  • usr/share/doc/qt/qt3d/images/multiviewport-2.png
  • usr/share/doc/qt/qt3d/images/multiviewport-qml-example.jpg
  • usr/share/doc/qt/qt3d/images/multiviewport.png
  • usr/share/doc/qt/qt3d/images/pbr-materials.png
  • usr/share/doc/qt/qt3d/images/planets-qml-example.jpg
  • usr/share/doc/qt/qt3d/images/qt3d-wireframe-rendering.png
  • usr/share/doc/qt/qt3d/images/scene2d.png
  • usr/share/doc/qt/qt3d/images/scene3d.png
  • usr/share/doc/qt/qt3d/images/shadowmapping-depth.png
  • usr/share/doc/qt/qt3d/images/shadowmapping-qt3d.png
  • usr/share/doc/qt/qt3d/images/simple-cpp.png
  • usr/share/doc/qt/qt3d/images/simple-custom-material.jpg
  • usr/share/doc/qt/qt3d/images/simple-framegraph.png
  • usr/share/doc/qt/qt3d/images/simple-qml.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/
  • usr/share/doc/qt/qt3d/images/used-in-examples/advancedcustommaterial/
  • usr/share/doc/qt/qt3d/images/used-in-examples/advancedcustommaterial/textures/
  • usr/share/doc/qt/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterDiffuse.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterNormal.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterSpecular.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/advancedcustommaterial/textures/Waterwave.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/advancedcustommaterial/textures/foam.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/advancedcustommaterial/textures/sky.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/albumcover.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/demotitle.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/normalmap.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausehoverpressed.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausenormal.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/playhoverpressed.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/playnormal.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/songtitle.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopdisabled.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/stophoverpressed.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopnormal.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/android/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/android/res/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/android/res/drawable-hdpi/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/android/res/drawable-hdpi/icon.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/android/res/drawable-ldpi/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/android/res/drawable-ldpi/icon.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/android/res/drawable-mdpi/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/android/res/drawable-mdpi/icon.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/earth.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/jupiter.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/mars.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/mercury.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/nasa/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/nasa/uranusringcolortrans.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/neptune.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/saturn.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthcloudmapcolortrans.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthcloudmapspec.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthmap2k.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthnormal2k.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthspec2k.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/galaxy_starfield.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/jupitermap.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/marsmap2k.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/marsnormal2k.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/mercurymap.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/mercurynormal.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/moonmap2k.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/moonnormal2k.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/neptunemap.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/saturnmap.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/saturnringcolortrans.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/sunmap.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/uranusmap.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/venusmap.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/venusnormal.jpg
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/sun.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/uranus.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/images/venus.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient WatchKit App/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient WatchKit App/Assets.xcassets/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient WatchKit App/Assets.xcassets/AppIcon.appiconset/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient WatchKit App/Assets.xcassets/AppIcon.appiconset/home_icon.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/Assets.xcassets/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/Assets.xcassets/AppIcon.appiconset/
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/Assets.xcassets/AppIcon.appiconset/icon120.png
  • usr/share/doc/qt/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/Assets.xcassets/AppIcon.appiconset/icon180.png
  • usr/share/doc/qt/qt3d/images/wave.png
  • usr/share/doc/qt/qt3d/images/widgets-scene3d.png
  • usr/share/doc/qt/qt3d/qml-computecommand-members.html
  • usr/share/doc/qt/qt3d/qml-computecommand.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractanimation-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractanimation.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractclipanimator-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractclipanimator.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractclipblendnode-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractclipblendnode.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-additiveclipblend-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-additiveclipblend.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-animationcontroller-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-animationcontroller.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-animationgroup-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-animationgroup.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-blendedclipanimator-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-blendedclipanimator.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-clipanimator-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-clipanimator.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-keyframeanimation-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-keyframeanimation.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-lerpblend-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-lerpblend.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-morphinganimation-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-morphinganimation.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-morphtarget-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-morphtarget.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-vertexblendanimation-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-animation-vertexblendanimation.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-abstractskeleton-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-abstractskeleton.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-armature-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-armature.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-component3d-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-component3d.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-entity-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-entity.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-entityloader-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-entityloader.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-joint-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-joint.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-node-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-node.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-nodeinstantiator-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-nodeinstantiator.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-quaternionanimation-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-quaternionanimation.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-skeleton-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-skeleton.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-skeletonloader-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-skeletonloader.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-transform-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-core-transform.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-conegeometry-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-conegeometry.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-conemesh-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-conemesh.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-cuboidgeometry-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-cuboidgeometry.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-cuboidmesh-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-cuboidmesh.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-cylindergeometry-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-cylindergeometry.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-cylindermesh-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-cylindermesh.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusemapmaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusemapmaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusespecularmapmaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusespecularmapmaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusespecularmaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusespecularmaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-extrudedtextgeometry-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-extrudedtextgeometry.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-extrudedtextmesh-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-extrudedtextmesh.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-firstpersoncameracontroller-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-firstpersoncameracontroller.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-forwardrenderer-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-forwardrenderer-obsolete.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-forwardrenderer.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-goochmaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-goochmaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusemapmaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusemapmaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-orbitcameracontroller-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-orbitcameracontroller.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-pervertexcolormaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-pervertexcolormaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-phongalphamaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-phongalphamaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-phongmaterial-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-phongmaterial.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-planegeometry-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-planegeometry.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-planemesh-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-planemesh.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-spheregeometry-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-spheregeometry.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-spheremesh-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-spheremesh.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-text2dentity-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-text2dentity.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-torusgeometry-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-torusgeometry.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-torusmesh-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-extras-torusmesh.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-abstractactioninput-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-abstractactioninput.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-abstractaxisinput-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-abstractaxisinput.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-abstractphysicaldevice-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-abstractphysicaldevice.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-action-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-action.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-actioninput-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-actioninput.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-analogaxisinput-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-analogaxisinput.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-axis-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-axis.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-axisaccumulator-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-axisaccumulator.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-axissetting-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-axissetting.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-buttonaxisinput-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-buttonaxisinput.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-inputchord-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-inputchord.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-inputsequence-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-inputsequence.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-inputsettings-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-inputsettings.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-keyboarddevice-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-keyboarddevice.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-keyboardhandler-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-keyboardhandler.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-keyevent-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-keyevent.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-logicaldevice-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-logicaldevice.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-mousedevice-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-mousedevice.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-mouseevent-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-mouseevent.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-mousehandler-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-mousehandler.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-wheelevent-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-input-wheelevent.html
  • usr/share/doc/qt/qt3d/qml-qt3d-logic-frameaction-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-logic-frameaction.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-abstractraycaster-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-abstractraycaster.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-abstracttextureimage-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-abstracttextureimage.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-alphacoverage-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-alphacoverage.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-alphatest-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-alphatest.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-attribute-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-attribute.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-blendequation-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-blendequation.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-blendequationarguments-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-blendequationarguments.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-blitframebuffer-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-blitframebuffer.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-buffer-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-buffer-obsolete.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-buffer.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-camera-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-camera-obsolete.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-camera.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-cameralens-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-cameralens.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-cameraselector-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-cameraselector.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-clearbuffers-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-clearbuffers.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-clipplane-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-clipplane.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-colormask-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-colormask.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-cullface-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-cullface.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-depthtest-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-depthtest.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-directionallight-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-directionallight.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-dispatchcompute-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-dispatchcompute.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-dithering-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-dithering.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-effect-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-effect.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-environmentlight-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-environmentlight.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-filterkey-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-filterkey.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-framegraphnode-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-framegraphnode.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-frontface-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-frontface.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-frustumculling-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-frustumculling.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-geometry-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-geometry.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-geometryrenderer-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-geometryrenderer.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-graphicsapifilter-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-graphicsapifilter.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-layer-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-layer.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-layerfilter-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-layerfilter.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetail-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetail.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailboundingsphere-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailboundingsphere.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailloader-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailloader.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailswitch-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailswitch.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-light-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-light.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-linewidth-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-linewidth.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-material-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-material.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-memorybarrier-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-memorybarrier.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-mesh-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-mesh.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-multisampleantialiasing-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-multisampleantialiasing.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-nodepthmask-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-nodepthmask.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-nodraw-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-nodraw.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-objectpicker-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-objectpicker.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-parameter-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-parameter.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pickevent-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pickevent.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pickingsettings-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pickingsettings.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-picklineevent-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-picklineevent.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pickpointevent-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pickpointevent.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-picktriangleevent-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-picktriangleevent.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pointlight-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pointlight.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pointsize-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-pointsize.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-polygonoffset-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-polygonoffset.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-proximityfilter-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-proximityfilter.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-raycaster-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-raycaster.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapture-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapture-obsolete.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapture.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapturereply-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapturereply-obsolete.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapturereply.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-renderpass-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-renderpass.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-renderpassfilter-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-renderpassfilter.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendersettings-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendersettings.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-renderstateset-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-renderstateset.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendersurfaceselector-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendersurfaceselector.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendertarget-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendertarget.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendertargetoutput-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendertargetoutput.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendertargetselector-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-rendertargetselector.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-sceneloader-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-sceneloader.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-scissortest-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-scissortest.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-screenraycaster-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-screenraycaster.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-seamlesscubemap-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-seamlesscubemap.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-shaderprogram-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-shaderprogram.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-shaderprogrambuilder-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-shaderprogrambuilder.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-sortpolicy-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-sortpolicy.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-spotlight-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-spotlight.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stencilmask-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stencilmask.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stenciloperation-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stenciloperation.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stenciloperationarguments-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stenciloperationarguments.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stenciltest-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stenciltest.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stenciltestarguments-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-stenciltestarguments.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-technique-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-technique.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-techniquefilter-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-techniquefilter.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-textureimage-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-textureimage.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-viewport-members.html
  • usr/share/doc/qt/qt3d/qml-qt3d-render-viewport.html
  • usr/share/doc/qt/qt3d/qml-qtquick-scene2d-scene2d-members.html
  • usr/share/doc/qt/qt3d/qml-qtquick-scene2d-scene2d.html
  • usr/share/doc/qt/qt3d/qml-qtquick-scene3d-scene3d-members.html
  • usr/share/doc/qt/qt3d/qml-qtquick-scene3d-scene3d.html
  • usr/share/doc/qt/qt3d/qml-renderstate-members.html
  • usr/share/doc/qt/qt3d/qml-renderstate.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-advancedcustommaterial-pro.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-example.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-models-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-qml-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-sceneroot-qml.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-shaders-es2-water-vert.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-shaders-gl3-water-vert.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-shaders-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-textures-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-water-qml.html
  • usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-watermaterial-qml.html
  • usr/share/doc/qt/qt3d/qt3d-animation-qmlmodule.html
  • usr/share/doc/qt/qt3d/qt3d-attribution-assimp.html
  • usr/share/doc/qt/qt3d/qt3d-attribution-gltf-wine.html
  • usr/share/doc/qt/qt3d/qt3d-attribution-miramar-sky.html
  • usr/share/doc/qt/qt3d/qt3d-attribution-nasa-jpl.html
  • usr/share/doc/qt/qt3d/qt3d-attribution-solar-system-scope.html
  • usr/share/doc/qt/qt3d/qt3d-attribution-substance-share.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-pro.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-barentity-qml.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-example.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-touchsettings-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-touchsettings-h.html
  • usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-visualizer-qml.html
  • usr/share/doc/qt/qt3d/qt3d-basicshapes-cpp-basicshapes-cpp-pro.html
  • usr/share/doc/qt/qt3d/qt3d-basicshapes-cpp-example.html
  • usr/share/doc/qt/qt3d/qt3d-basicshapes-cpp-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-basicshapes-cpp-scenemodifier-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-basicshapes-cpp-scenemodifier-h.html
  • usr/share/doc/qt/qt3d/qt3d-core-qmlmodule.html
  • usr/share/doc/qt/qt3d/qt3d-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-examples.html
  • usr/share/doc/qt/qt3d/qt3d-extras-qmlmodule.html
  • usr/share/doc/qt/qt3d/qt3d-index.html
  • usr/share/doc/qt/qt3d/qt3d-input-qmlmodule.html
  • usr/share/doc/qt/qt3d/qt3d-logic-qmlmodule.html
  • usr/share/doc/qt/qt3d/qt3d-multiviewport-example.html
  • usr/share/doc/qt/qt3d/qt3d-multiviewport-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-multiviewport-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-multiviewport-multiviewport-pro.html
  • usr/share/doc/qt/qt3d/qt3d-multiviewport-multiviewport-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-multiviewport-quadviewportframegraph-qml.html
  • usr/share/doc/qt/qt3d/qt3d-multiviewport-simplecamera-qml.html
  • usr/share/doc/qt/qt3d/qt3d-overview.html
  • usr/share/doc/qt/qt3d/qt3d-pbr-materials-basiccamera-qml.html
  • usr/share/doc/qt/qt3d/qt3d-pbr-materials-example.html
  • usr/share/doc/qt/qt3d/qt3d-pbr-materials-lights-qml.html
  • usr/share/doc/qt/qt3d/qt3d-pbr-materials-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-pbr-materials-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-pbr-materials-materials-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-pbr-materials-pbr-materials-pro.html
  • usr/share/doc/qt/qt3d/qt3d-pbr-materials-trefoilknot-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-android-androidmanifest-xml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-appletvinput-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-example.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-fpsdisplay-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-infosheet-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-networkcontroller-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-networkcontroller-h.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planet-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planetbutton-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planeteffect-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planetframegraph-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planetmaterial-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planets-js.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planets-qml-images-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planets-qml-pro.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planets-qml-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-appdelegate-h.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-viewcontroller-h.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-watchkit-extension-extensiondelegate-h.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-watchkit-extension-interfacecontroller-h.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planetslight-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-planetsmain-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-ring-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shaders-es2-planetd-vert.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shaders-es2-planetdb-vert.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shaders-es2-sun-vert.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shaders-gl3-planetd-vert.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shaders-gl3-planetdb-vert.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shaders-gl3-planetdshadow-vert.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shaders-gl3-shadowmap-vert.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shaders-gl3-sun-vert.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-shadoweffect-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-solarsystem-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-styledslider-qml.html
  • usr/share/doc/qt/qt3d/qt3d-planets-qml-suneffect-qml.html
  • usr/share/doc/qt/qt3d/qt3d-qml.html
  • usr/share/doc/qt/qt3d/qt3d-render-qmlmodule.html
  • usr/share/doc/qt/qt3d/qt3d-scene2d-example.html
  • usr/share/doc/qt/qt3d/qt3d-scene2d-logocontrols-qml.html
  • usr/share/doc/qt/qt3d/qt3d-scene2d-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-scene2d-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-scene2d-scene2d-pro.html
  • usr/share/doc/qt/qt3d/qt3d-scene2d-scene2d-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-scene3d-animatedentity-qml.html
  • usr/share/doc/qt/qt3d/qt3d-scene3d-example.html
  • usr/share/doc/qt/qt3d/qt3d-scene3d-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-scene3d-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-scene3d-scene3d-pro.html
  • usr/share/doc/qt/qt3d/qt3d-scene3d-scene3d-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-adseffect-qml.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-adsmaterial-qml.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-example.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-groundplane-qml.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-shaders-ads-vert.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-shaders-es3-ads-vert.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-shaders-es3-shadowmap-vert.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-shaders-shadowmap-vert.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-shadow-map-qml-pro.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-shadow-map-qml-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-shadowmapframegraph-qml.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-shadowmaplight-qml.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-toyplane-qml.html
  • usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-trefoil-qml.html
  • usr/share/doc/qt/qt3d/qt3d-simple-cpp-example.html
  • usr/share/doc/qt/qt3d/qt3d-simple-cpp-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-simple-cpp-orbittransformcontroller-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-simple-cpp-orbittransformcontroller-h.html
  • usr/share/doc/qt/qt3d/qt3d-simple-cpp-simple-cpp-pro.html
  • usr/share/doc/qt/qt3d/qt3d-simple-qml-example.html
  • usr/share/doc/qt/qt3d/qt3d-simple-qml-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-simple-qml-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-simple-qml-simple-qml-pro.html
  • usr/share/doc/qt/qt3d/qt3d-simple-qml-simple-qml-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-example.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-models-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-planemodel-qml.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-qml-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-sceneroot-qml.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-shaders-es2-simplecolor-vert.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-shaders-gl3-simplecolor-vert.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-shaders-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-simplecustommaterial-pro.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-simplematerial-qml.html
  • usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-textures-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-wave-background-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wave-backgroundeffect-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wave-basiccamera-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wave-example.html
  • usr/share/doc/qt/qt3d/qt3d-wave-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-wave-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wave-shaders-background-vert.html
  • usr/share/doc/qt/qt3d/qt3d-wave-shaders-ribbon-vert.html
  • usr/share/doc/qt/qt3d/qt3d-wave-shaders-robustwireframe-geom.html
  • usr/share/doc/qt/qt3d/qt3d-wave-wave-pro.html
  • usr/share/doc/qt/qt3d/qt3d-wave-wave-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wave-wave-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-wave-waveeffect-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wave-waveforwardrenderer-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wave-wavematerial-qml.html
  • usr/share/doc/qt/qt3d/qt3d-widgets-scene3d-example.html
  • usr/share/doc/qt/qt3d/qt3d-widgets-scene3d-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-widgets-scene3d-widgets-scene3d-pro.html
  • usr/share/doc/qt/qt3d/qt3d-widgets-scene3d-widgets-scene3d-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-basiccamera-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-example.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-main-cpp.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-main-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-shaders-robustwireframe-geom.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-shaders-robustwireframe-vert.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-trefoilknot-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-wireframe-pro.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-wireframe-qrc.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-wireframeeffect-qml.html
  • usr/share/doc/qt/qt3d/qt3d-wireframe-wireframematerial-qml.html
  • usr/share/doc/qt/qt3d/qt3d.index
  • usr/share/doc/qt/qt3d/qt3d.qhp
  • usr/share/doc/qt/qt3d/qt3d.qhp.sha1
  • usr/share/doc/qt/qt3d/qt3d.tags
  • usr/share/doc/qt/qt3d/qt3danimation-module.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractanimation-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractanimation-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractanimation.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractanimationclip-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractanimationclip-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractanimationclip.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractchannelmapping-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractchannelmapping.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractclipanimator-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractclipanimator-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractclipanimator.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractclipblendnode-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractclipblendnode-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qabstractclipblendnode.html
  • usr/share/doc/qt/qt3d/qt3danimation-qadditiveclipblend-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qadditiveclipblend-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qadditiveclipblend.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationaspect-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationaspect-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationaspect.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationcallback-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationcallback.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationclip-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationclip-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationclip.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationclipdata-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationclipdata.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationcliploader-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationcliploader-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationcliploader.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationcontroller-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationcontroller-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationcontroller.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationgroup-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationgroup-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qanimationgroup.html
  • usr/share/doc/qt/qt3d/qt3danimation-qblendedclipanimator-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qblendedclipanimator-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qblendedclipanimator.html
  • usr/share/doc/qt/qt3d/qt3danimation-qcallbackmapping-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qcallbackmapping-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qcallbackmapping.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannel-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannel.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelcomponent-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelcomponent.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmapper-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmapper-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmapper.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmapping-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmapping-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmapping.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmappingcreatedchange-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmappingcreatedchange.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmappingcreatedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qchannelmappingcreatedchangebase.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipanimator-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipanimator-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipanimator.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipblendnodecreatedchange-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipblendnodecreatedchange.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipblendnodecreatedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipblendnodecreatedchangebase.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipblendvalue-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipblendvalue-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclipblendvalue.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclock-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qclock.html
  • usr/share/doc/qt/qt3d/qt3danimation-qkeyframe-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qkeyframe.html
  • usr/share/doc/qt/qt3d/qt3danimation-qkeyframeanimation-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qkeyframeanimation-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qkeyframeanimation.html
  • usr/share/doc/qt/qt3d/qt3danimation-qlerpclipblend-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qlerpclipblend-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qlerpclipblend.html
  • usr/share/doc/qt/qt3d/qt3danimation-qmorphinganimation-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qmorphinganimation-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qmorphinganimation.html
  • usr/share/doc/qt/qt3d/qt3danimation-qmorphtarget-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qmorphtarget-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qmorphtarget.html
  • usr/share/doc/qt/qt3d/qt3danimation-qskeletonmapping-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qskeletonmapping.html
  • usr/share/doc/qt/qt3d/qt3danimation-qvertexblendanimation-members.html
  • usr/share/doc/qt/qt3d/qt3danimation-qvertexblendanimation-obsolete.html
  • usr/share/doc/qt/qt3d/qt3danimation-qvertexblendanimation.html
  • usr/share/doc/qt/qt3d/qt3danimation.html
  • usr/share/doc/qt/qt3d/qt3dcore-module.html
  • usr/share/doc/qt/qt3d/qt3dcore-qabstractaspect-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qabstractaspect-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qabstractaspect.html
  • usr/share/doc/qt/qt3d/qt3dcore-qabstractskeleton-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qabstractskeleton-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qabstractskeleton.html
  • usr/share/doc/qt/qt3d/qt3dcore-qarmature-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qarmature-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qarmature.html
  • usr/share/doc/qt/qt3d/qt3dcore-qaspectengine-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qaspectengine-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qaspectengine.html
  • usr/share/doc/qt/qt3d/qt3dcore-qaspectjob-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qaspectjob.html
  • usr/share/doc/qt/qt3d/qt3dcore-qbackendnode-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qbackendnode.html
  • usr/share/doc/qt/qt3d/qt3dcore-qbackendnodemapper-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qbackendnodemapper.html
  • usr/share/doc/qt/qt3d/qt3dcore-qcomponent-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qcomponent-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qcomponent.html
  • usr/share/doc/qt/qt3d/qt3dcore-qcomponentaddedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qcomponentaddedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qcomponentremovedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qcomponentremovedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qdynamicpropertyupdatedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qdynamicpropertyupdatedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qentity-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qentity-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qentity.html
  • usr/share/doc/qt/qt3d/qt3dcore-qjoint-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qjoint-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qjoint.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnode-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnode-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnode.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodecommand-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodecommand.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodecreatedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodecreatedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodecreatedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodecreatedchangebase.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodedestroyedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodedestroyedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodeid-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodeid.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodeidtypepair-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qnodeidtypepair.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertynodeaddedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertynodeaddedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertynoderemovedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertynoderemovedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyupdatedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyupdatedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyupdatedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyupdatedchangebase.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueaddedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueaddedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueaddedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueaddedchangebase.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueremovedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueremovedchange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueremovedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueremovedchangebase.html
  • usr/share/doc/qt/qt3d/qt3dcore-qscenechange-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qscenechange.html
  • usr/share/doc/qt/qt3d/qt3dcore-qskeleton-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qskeleton-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qskeleton.html
  • usr/share/doc/qt/qt3d/qt3dcore-qskeletonloader-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qskeletonloader-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qskeletonloader.html
  • usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyupdatedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyupdatedchangebase.html
  • usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase.html
  • usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase.html
  • usr/share/doc/qt/qt3d/qt3dcore-qtransform-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-qtransform-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-qtransform.html
  • usr/share/doc/qt/qt3d/qt3dcore-quick-qqmlaspectengine-members.html
  • usr/share/doc/qt/qt3d/qt3dcore-quick-qqmlaspectengine-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dcore-quick-qqmlaspectengine.html
  • usr/share/doc/qt/qt3d/qt3dcore-quick.html
  • usr/share/doc/qt/qt3d/qt3dcore.html
  • usr/share/doc/qt/qt3d/qt3dextras-module.html
  • usr/share/doc/qt/qt3d/qt3dextras-qabstractcameracontroller-inputstate-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qabstractcameracontroller-inputstate.html
  • usr/share/doc/qt/qt3d/qt3dextras-qabstractcameracontroller-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qabstractcameracontroller-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qabstractcameracontroller.html
  • usr/share/doc/qt/qt3d/qt3dextras-qabstractspritesheet-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qabstractspritesheet.html
  • usr/share/doc/qt/qt3d/qt3dextras-qconegeometry-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qconegeometry-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qconegeometry.html
  • usr/share/doc/qt/qt3d/qt3dextras-qconemesh-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qconemesh-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qconemesh.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcuboidgeometry-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcuboidgeometry-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcuboidgeometry.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcuboidmesh-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcuboidmesh-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcuboidmesh.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcylindergeometry-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcylindergeometry-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcylindergeometry.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcylindermesh-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcylindermesh-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qcylindermesh.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusemapmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusemapmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusemapmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmapmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmapmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmapmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextgeometry-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextgeometry-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextgeometry.html
  • usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextmesh-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextmesh-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextmesh.html
  • usr/share/doc/qt/qt3d/qt3dextras-qfirstpersoncameracontroller-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qfirstpersoncameracontroller-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qfirstpersoncameracontroller.html
  • usr/share/doc/qt/qt3d/qt3dextras-qforwardrenderer-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qforwardrenderer-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qforwardrenderer.html
  • usr/share/doc/qt/qt3d/qt3dextras-qgoochmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qgoochmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qgoochmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qmetalroughmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qmetalroughmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qmetalroughmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qmorphphongmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qmorphphongmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qmorphphongmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapalphamaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qorbitcameracontroller-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qorbitcameracontroller-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qorbitcameracontroller.html
  • usr/share/doc/qt/qt3d/qt3dextras-qpervertexcolormaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qpervertexcolormaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qpervertexcolormaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qphongalphamaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qphongalphamaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qphongalphamaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qphongmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qphongmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qphongmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qplanegeometry-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qplanegeometry-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qplanegeometry.html
  • usr/share/doc/qt/qt3d/qt3dextras-qplanemesh-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qplanemesh-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qplanemesh.html
  • usr/share/doc/qt/qt3d/qt3dextras-qskyboxentity-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qskyboxentity-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qskyboxentity.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspheregeometry-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspheregeometry-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspheregeometry.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspheremesh-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspheremesh-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspheremesh.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspritegrid-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspritegrid.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspritesheet-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspritesheet.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspritesheetitem-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qspritesheetitem.html
  • usr/share/doc/qt/qt3d/qt3dextras-qt3dwindow-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qt3dwindow.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtext2dentity-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtext2dentity-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtext2dentity.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtexturedmetalroughmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtexturedmetalroughmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtexturedmetalroughmaterial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtexturematerial-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtexturematerial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtexturematerial.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtorusgeometry-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtorusgeometry-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtorusgeometry.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtorusmesh-members.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtorusmesh-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-qtorusmesh.html
  • usr/share/doc/qt/qt3d/qt3dextras-sub-qt3d-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dextras-sub-qt3d.html
  • usr/share/doc/qt/qt3d/qt3dinput-module.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractactioninput-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractactioninput-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractactioninput.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractaxisinput-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractaxisinput-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractaxisinput.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldevice-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldevice-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldevice.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldeviceproxy-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldeviceproxy-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldeviceproxy.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaction-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaction-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaction.html
  • usr/share/doc/qt/qt3d/qt3dinput-qactioninput-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qactioninput-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qactioninput.html
  • usr/share/doc/qt/qt3d/qt3dinput-qanalogaxisinput-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qanalogaxisinput-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qanalogaxisinput.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxis-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxis-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxis.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxisaccumulator-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxisaccumulator-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxisaccumulator.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxissetting-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxissetting-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qaxissetting.html
  • usr/share/doc/qt/qt3d/qt3dinput-qbuttonaxisinput-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qbuttonaxisinput-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qbuttonaxisinput.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputaspect-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputaspect-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputaspect.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputchord-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputchord-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputchord.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputdeviceintegration-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputdeviceintegration-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputdeviceintegration.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputsequence-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputsequence-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputsequence.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputsettings-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputsettings-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qinputsettings.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyboarddevice-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyboarddevice-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyboarddevice.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyboardhandler-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyboardhandler-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyboardhandler.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyevent-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyevent-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qkeyevent.html
  • usr/share/doc/qt/qt3d/qt3dinput-qlogicaldevice-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qlogicaldevice-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qlogicaldevice.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmousedevice-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmousedevice-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmousedevice.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmouseevent-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmouseevent-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmouseevent.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmousehandler-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmousehandler-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qmousehandler.html
  • usr/share/doc/qt/qt3d/qt3dinput-qphysicaldevicecreatedchange-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qphysicaldevicecreatedchange.html
  • usr/share/doc/qt/qt3d/qt3dinput-qphysicaldevicecreatedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qphysicaldevicecreatedchangebase.html
  • usr/share/doc/qt/qt3d/qt3dinput-qwheelevent-members.html
  • usr/share/doc/qt/qt3d/qt3dinput-qwheelevent-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dinput-qwheelevent.html
  • usr/share/doc/qt/qt3d/qt3dinput-sub-qt3d.html
  • usr/share/doc/qt/qt3d/qt3dlogic-logic.html
  • usr/share/doc/qt/qt3d/qt3dlogic-module.html
  • usr/share/doc/qt/qt3d/qt3dlogic-qframeaction-members.html
  • usr/share/doc/qt/qt3d/qt3dlogic-qframeaction-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dlogic-qframeaction.html
  • usr/share/doc/qt/qt3d/qt3dlogic-qlogicaspect-members.html
  • usr/share/doc/qt/qt3d/qt3dlogic-qlogicaspect-obsolete.html
  • usr/share/doc/qt/qt3d/qt3dlogic-qlogicaspect.html
  • usr/share/doc/qt/qt3d/qt3dlogic-sub-qt3d.html
  • usr/share/doc/qt/qt3d/qt3drender-fbxgeometryloader-members.html
  • usr/share/doc/qt/qt3d/qt3drender-fbxgeometryloader.html
  • usr/share/doc/qt/qt3d/qt3drender-framegraph.html
  • usr/share/doc/qt/qt3d/qt3drender-functortype-members.html
  • usr/share/doc/qt/qt3d/qt3drender-functortype.html
  • usr/share/doc/qt/qt3d/qt3drender-geometry.html
  • usr/share/doc/qt/qt3d/qt3drender-gltfgeometryloader-members.html
  • usr/share/doc/qt/qt3d/qt3drender-gltfgeometryloader.html
  • usr/share/doc/qt/qt3d/qt3drender-module.html
  • usr/share/doc/qt/qt3d/qt3drender-objgeometryloader-members.html
  • usr/share/doc/qt/qt3d/qt3drender-objgeometryloader.html
  • usr/share/doc/qt/qt3d/qt3drender-plygeometryloader-element-members.html
  • usr/share/doc/qt/qt3d/qt3drender-plygeometryloader-element.html
  • usr/share/doc/qt/qt3d/qt3drender-plygeometryloader-members.html
  • usr/share/doc/qt/qt3d/qt3drender-plygeometryloader-property-members.html
  • usr/share/doc/qt/qt3d/qt3drender-plygeometryloader-property.html
  • usr/share/doc/qt/qt3d/qt3drender-plygeometryloader.html
  • usr/share/doc/qt/qt3d/qt3drender-propertyreaderinterface-members.html
  • usr/share/doc/qt/qt3d/qt3drender-propertyreaderinterface.html
  • usr/share/doc/qt/qt3d/qt3drender-protips.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstractfunctor-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstractfunctor.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstractlight-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstractlight-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstractlight.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstractraycaster-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstractraycaster-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstractraycaster.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstracttexture-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstracttexture-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstracttexture.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstracttextureimage-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstracttextureimage-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qabstracttextureimage.html
  • usr/share/doc/qt/qt3d/qt3drender-qalphacoverage-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qalphacoverage-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qalphacoverage.html
  • usr/share/doc/qt/qt3d/qt3drender-qalphatest-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qalphatest-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qalphatest.html
  • usr/share/doc/qt/qt3d/qt3drender-qattribute-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qattribute-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qattribute.html
  • usr/share/doc/qt/qt3d/qt3drender-qblendequation-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qblendequation-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qblendequation.html
  • usr/share/doc/qt/qt3d/qt3drender-qblendequationarguments-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qblendequationarguments-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qblendequationarguments.html
  • usr/share/doc/qt/qt3d/qt3drender-qblitframebuffer-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qblitframebuffer-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qblitframebuffer.html
  • usr/share/doc/qt/qt3d/qt3drender-qbuffer-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qbuffer-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qbuffer.html
  • usr/share/doc/qt/qt3d/qt3drender-qbuffercapture-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qbuffercapture-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qbuffercapture.html
  • usr/share/doc/qt/qt3d/qt3drender-qbufferdatagenerator-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qbufferdatagenerator.html
  • usr/share/doc/qt/qt3d/qt3drender-qcamera-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qcamera-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qcamera.html
  • usr/share/doc/qt/qt3d/qt3drender-qcameralens-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qcameralens-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qcameralens.html
  • usr/share/doc/qt/qt3d/qt3drender-qcameraselector-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qcameraselector-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qcameraselector.html
  • usr/share/doc/qt/qt3d/qt3drender-qclearbuffers-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qclearbuffers-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qclearbuffers.html
  • usr/share/doc/qt/qt3d/qt3drender-qclipplane-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qclipplane-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qclipplane.html
  • usr/share/doc/qt/qt3d/qt3drender-qcolormask-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qcolormask-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qcolormask.html
  • usr/share/doc/qt/qt3d/qt3drender-qcomputecommand-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qcomputecommand-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qcomputecommand.html
  • usr/share/doc/qt/qt3d/qt3drender-qcullface-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qcullface-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qcullface.html
  • usr/share/doc/qt/qt3d/qt3drender-qdepthtest-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qdepthtest-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qdepthtest.html
  • usr/share/doc/qt/qt3d/qt3drender-qdirectionallight-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qdirectionallight-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qdirectionallight.html
  • usr/share/doc/qt/qt3d/qt3drender-qdispatchcompute-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qdispatchcompute-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qdispatchcompute.html
  • usr/share/doc/qt/qt3d/qt3drender-qdithering-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qdithering-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qdithering.html
  • usr/share/doc/qt/qt3d/qt3drender-qeffect-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qeffect-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qeffect.html
  • usr/share/doc/qt/qt3d/qt3drender-qenvironmentlight-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qenvironmentlight-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qenvironmentlight.html
  • usr/share/doc/qt/qt3d/qt3drender-qfilterkey-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qfilterkey-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qfilterkey.html
  • usr/share/doc/qt/qt3d/qt3drender-qframegraphnode-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qframegraphnode-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qframegraphnode.html
  • usr/share/doc/qt/qt3d/qt3drender-qframegraphnodecreatedchange-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qframegraphnodecreatedchange.html
  • usr/share/doc/qt/qt3d/qt3drender-qframegraphnodecreatedchangebase-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qframegraphnodecreatedchangebase.html
  • usr/share/doc/qt/qt3d/qt3drender-qfrontface-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qfrontface-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qfrontface.html
  • usr/share/doc/qt/qt3d/qt3drender-qfrustumculling-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qfrustumculling-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qfrustumculling.html
  • usr/share/doc/qt/qt3d/qt3drender-qgeometry-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qgeometry-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qgeometry.html
  • usr/share/doc/qt/qt3d/qt3drender-qgeometryfactory-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qgeometryfactory.html
  • usr/share/doc/qt/qt3d/qt3drender-qgeometryrenderer-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qgeometryrenderer-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qgeometryrenderer.html
  • usr/share/doc/qt/qt3d/qt3drender-qgraphicsapifilter-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qgraphicsapifilter-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qgraphicsapifilter.html
  • usr/share/doc/qt/qt3d/qt3drender-qlayer-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qlayer-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qlayer.html
  • usr/share/doc/qt/qt3d/qt3drender-qlayerfilter-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qlayerfilter-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qlayerfilter.html
  • usr/share/doc/qt/qt3d/qt3drender-qlevelofdetail-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qlevelofdetail-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qlevelofdetail.html
  • usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailboundingsphere-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailboundingsphere.html
  • usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailswitch-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailswitch-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailswitch.html
  • usr/share/doc/qt/qt3d/qt3drender-qlinewidth-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qlinewidth-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qlinewidth.html
  • usr/share/doc/qt/qt3d/qt3drender-qmaterial-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qmaterial-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qmaterial.html
  • usr/share/doc/qt/qt3d/qt3drender-qmemorybarrier-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qmemorybarrier-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qmemorybarrier.html
  • usr/share/doc/qt/qt3d/qt3drender-qmesh-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qmesh-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qmesh.html
  • usr/share/doc/qt/qt3d/qt3drender-qmultisampleantialiasing-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qmultisampleantialiasing-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qmultisampleantialiasing.html
  • usr/share/doc/qt/qt3d/qt3drender-qnodepthmask-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qnodepthmask-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qnodepthmask.html
  • usr/share/doc/qt/qt3d/qt3drender-qnodraw-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qnodraw-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qnodraw.html
  • usr/share/doc/qt/qt3d/qt3drender-qobjectpicker-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qobjectpicker-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qobjectpicker.html
  • usr/share/doc/qt/qt3d/qt3drender-qpaintedtextureimage-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpaintedtextureimage-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpaintedtextureimage.html
  • usr/share/doc/qt/qt3d/qt3drender-qparameter-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qparameter-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qparameter.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickevent-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickevent-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickevent.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickingsettings-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickingsettings-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickingsettings.html
  • usr/share/doc/qt/qt3d/qt3drender-qpicklineevent-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpicklineevent-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpicklineevent.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickpointevent-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickpointevent-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpickpointevent.html
  • usr/share/doc/qt/qt3d/qt3drender-qpicktriangleevent-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpicktriangleevent-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpicktriangleevent.html
  • usr/share/doc/qt/qt3d/qt3drender-qpointlight-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpointlight-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpointlight.html
  • usr/share/doc/qt/qt3d/qt3drender-qpointsize-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpointsize-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpointsize.html
  • usr/share/doc/qt/qt3d/qt3drender-qpolygonoffset-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qpolygonoffset-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qpolygonoffset.html
  • usr/share/doc/qt/qt3d/qt3drender-qproximityfilter-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qproximityfilter-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qproximityfilter.html
  • usr/share/doc/qt/qt3d/qt3drender-qraycaster-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qraycaster-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qraycaster.html
  • usr/share/doc/qt/qt3d/qt3drender-qraycasterhit-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qraycasterhit.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderaspect-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderaspect-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderaspect.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendercapture-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendercapture-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendercapture.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendercapturereply-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendercapturereply-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendercapturereply.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderpass-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderpass-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderpass.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderpassfilter-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderpassfilter-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderpassfilter.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendersettings-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendersettings-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendersettings.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderstate-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderstate-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderstate.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderstateset-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderstateset-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrenderstateset.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendersurfaceselector-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendersurfaceselector-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendersurfaceselector.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertarget-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertarget-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertarget.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertargetoutput-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertargetoutput-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertargetoutput.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertargetselector-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertargetselector-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qrendertargetselector.html
  • usr/share/doc/qt/qt3d/qt3drender-qsceneloader-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qsceneloader-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qsceneloader.html
  • usr/share/doc/qt/qt3d/qt3drender-qscissortest-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qscissortest-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qscissortest.html
  • usr/share/doc/qt/qt3d/qt3drender-qscreenraycaster-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qscreenraycaster-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qscreenraycaster.html
  • usr/share/doc/qt/qt3d/qt3drender-qseamlesscubemap-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qseamlesscubemap-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qseamlesscubemap.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderdata-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderdata-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderdata.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderprogram-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderprogram-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderprogram.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderprogrambuilder-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderprogrambuilder-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qshaderprogrambuilder.html
  • usr/share/doc/qt/qt3d/qt3drender-qsortpolicy-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qsortpolicy-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qsortpolicy.html
  • usr/share/doc/qt/qt3d/qt3drender-qspotlight-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qspotlight-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qspotlight.html
  • usr/share/doc/qt/qt3d/qt3drender-qstencilmask-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qstencilmask-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qstencilmask.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciloperation-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciloperation-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciloperation.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciloperationarguments-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciloperationarguments-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciloperationarguments.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciltest-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciltest-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciltest.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciltestarguments-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciltestarguments-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qstenciltestarguments.html
  • usr/share/doc/qt/qt3d/qt3drender-qtechnique-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtechnique-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtechnique.html
  • usr/share/doc/qt/qt3d/qt3drender-qtechniquefilter-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtechniquefilter-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtechniquefilter.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture1d-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture1d-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture1d.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture1darray-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture1darray-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture1darray.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2d-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2d-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2d.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2darray-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2darray-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2darray.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisample-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisample-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisample.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisamplearray-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisamplearray-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisamplearray.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture3d-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture3d-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexture3d.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturebuffer-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturebuffer-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturebuffer.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturecubemap-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturecubemap-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturecubemap.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturecubemaparray-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturecubemaparray-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturecubemaparray.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturedata-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturedata.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturegenerator-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturegenerator.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureimage-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureimage-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureimage.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureimagedata-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureimagedata.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureimagedatagenerator-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureimagedatagenerator.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureloader-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureloader-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtextureloader.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturerectangle-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturerectangle-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturerectangle.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturewrapmode-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturewrapmode-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qtexturewrapmode.html
  • usr/share/doc/qt/qt3d/qt3drender-quick-qscene2d-members.html
  • usr/share/doc/qt/qt3d/qt3drender-quick-qscene2d-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-quick-qscene2d.html
  • usr/share/doc/qt/qt3d/qt3drender-quick-sub-qt3d.html
  • usr/share/doc/qt/qt3d/qt3drender-qviewport-members.html
  • usr/share/doc/qt/qt3d/qt3drender-qviewport-obsolete.html
  • usr/share/doc/qt/qt3d/qt3drender-qviewport.html
  • usr/share/doc/qt/qt3d/qt3drender-render.html
  • usr/share/doc/qt/qt3d/qt3drender-stlgeometryloader-members.html
  • usr/share/doc/qt/qt3d/qt3drender-stlgeometryloader.html
  • usr/share/doc/qt/qt3d/qt3drender.html
  • usr/share/doc/qt/qt3d/qt3dscene2d-module.html
  • usr/share/doc/qt/qt3d/qtquick-scene2d-qmlmodule.html
  • usr/share/doc/qt/qt3d/qtquick-scene3d-qmlmodule.html
  • usr/share/doc/qt/qt3d/style/
  • usr/share/doc/qt/qt3d/style/offline-simple.css
  • usr/share/doc/qt/qt3d/style/offline.css
  • usr/share/doc/qt/qtandroidextras.qch
  • usr/share/doc/qt/qtandroidextras/
  • usr/share/doc/qt/qtandroidextras/examples-manifest.xml
  • usr/share/doc/qt/qtandroidextras/examples-qtandroidextras.html
  • usr/share/doc/qt/qtandroidextras/images/
  • usr/share/doc/qt/qtandroidextras/images/arrow_bc.png
  • usr/share/doc/qt/qtandroidextras/images/bgrContent.png
  • usr/share/doc/qt/qtandroidextras/images/btn_next.png
  • usr/share/doc/qt/qtandroidextras/images/btn_prev.png
  • usr/share/doc/qt/qtandroidextras/images/bullet_dn.png
  • usr/share/doc/qt/qtandroidextras/images/bullet_sq.png
  • usr/share/doc/qt/qtandroidextras/images/home.png
  • usr/share/doc/qt/qtandroidextras/images/ico_note.png
  • usr/share/doc/qt/qtandroidextras/images/ico_note_attention.png
  • usr/share/doc/qt/qtandroidextras/images/ico_out.png
  • usr/share/doc/qt/qtandroidextras/images/logo.png
  • usr/share/doc/qt/qtandroidextras/images/notification.png
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/notification/
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/notification/android-sources/
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/notification/android-sources/res/
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/notification/android-sources/res/drawable/
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/notification/android-sources/res/drawable/icon.png
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/notification/images/
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/notification/images/happy.png
  • usr/share/doc/qt/qtandroidextras/images/used-in-examples/notification/images/sad.png
  • usr/share/doc/qt/qtandroidextras/qandroidactivityresultreceiver-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidactivityresultreceiver.html
  • usr/share/doc/qt/qtandroidextras/qandroidbinder-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidbinder.html
  • usr/share/doc/qt/qtandroidextras/qandroidintent-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidintent.html
  • usr/share/doc/qt/qtandroidextras/qandroidjnienvironment-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidjnienvironment.html
  • usr/share/doc/qt/qtandroidextras/qandroidjniexceptioncleaner-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidjniexceptioncleaner.html
  • usr/share/doc/qt/qtandroidextras/qandroidjniobject-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidjniobject.html
  • usr/share/doc/qt/qtandroidextras/qandroidparcel-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidparcel.html
  • usr/share/doc/qt/qtandroidextras/qandroidservice-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidservice-obsolete.html
  • usr/share/doc/qt/qtandroidextras/qandroidservice.html
  • usr/share/doc/qt/qtandroidextras/qandroidserviceconnection-members.html
  • usr/share/doc/qt/qtandroidextras/qandroidserviceconnection.html
  • usr/share/doc/qt/qtandroidextras/qtandroid.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-index.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-module.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-android-sources-androidmanifest-xml.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-android-sources-src-org-qtproject-example-notification-notificationclient-java.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-example.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-main-cpp.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-main-qrc.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-notification-pro.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-notificationclient-cpp.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-notificationclient-h.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-qml-main-qml.html
  • usr/share/doc/qt/qtandroidextras/qtandroidextras.index
  • usr/share/doc/qt/qtandroidextras/qtandroidextras.qhp
  • usr/share/doc/qt/qtandroidextras/qtandroidextras.qhp.sha1
  • usr/share/doc/qt/qtandroidextras/style/
  • usr/share/doc/qt/qtandroidextras/style/offline-simple.css
  • usr/share/doc/qt/qtandroidextras/style/offline.css
  • usr/share/doc/qt/qtassistant.qch
  • usr/share/doc/qt/qtassistant/
  • usr/share/doc/qt/qtassistant/assistant-custom-help-viewer.html
  • usr/share/doc/qt/qtassistant/assistant-details.html
  • usr/share/doc/qt/qtassistant/assistant-quick-guide.html
  • usr/share/doc/qt/qtassistant/examples-manifest.xml
  • usr/share/doc/qt/qtassistant/examples-qtassistant.html
  • usr/share/doc/qt/qtassistant/images/
  • usr/share/doc/qt/qtassistant/images/arrow_bc.png
  • usr/share/doc/qt/qtassistant/images/assistant-assistant.png
  • usr/share/doc/qt/qtassistant/images/assistant-bookmarks.png
  • usr/share/doc/qt/qtassistant/images/assistant-dockwidgets.png
  • usr/share/doc/qt/qtassistant/images/assistant-examples.png
  • usr/share/doc/qt/qtassistant/images/assistant-index.png
  • usr/share/doc/qt/qtassistant/images/assistant-preferences-documentation.png
  • usr/share/doc/qt/qtassistant/images/assistant-preferences-filters.png
  • usr/share/doc/qt/qtassistant/images/assistant-preferences-fonts.png
  • usr/share/doc/qt/qtassistant/images/assistant-preferences-options.png
  • usr/share/doc/qt/qtassistant/images/assistant-search.png
  • usr/share/doc/qt/qtassistant/images/bgrContent.png
  • usr/share/doc/qt/qtassistant/images/btn_next.png
  • usr/share/doc/qt/qtassistant/images/btn_prev.png
  • usr/share/doc/qt/qtassistant/images/bullet_dn.png
  • usr/share/doc/qt/qtassistant/images/bullet_sq.png
  • usr/share/doc/qt/qtassistant/images/home.png
  • usr/share/doc/qt/qtassistant/images/ico_note.png
  • usr/share/doc/qt/qtassistant/images/ico_note_attention.png
  • usr/share/doc/qt/qtassistant/images/ico_out.png
  • usr/share/doc/qt/qtassistant/images/logo.png
  • usr/share/doc/qt/qtassistant/images/simpletextviewer-example.png
  • usr/share/doc/qt/qtassistant/images/simpletextviewer-findfiledialog.png
  • usr/share/doc/qt/qtassistant/images/simpletextviewer-mainwindow.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/
  • usr/share/doc/qt/qtassistant/images/used-in-examples/remotecontrol/
  • usr/share/doc/qt/qtassistant/images/used-in-examples/remotecontrol/enter.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/browse.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/fadedfilemenu.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/filedialog.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/handbook.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/icon.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/mainwindow.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/open.png
  • usr/share/doc/qt/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/wildcard.png
  • usr/share/doc/qt/qtassistant/qtassistant-index.html
  • usr/share/doc/qt/qtassistant/qtassistant-remotecontrol-example.html
  • usr/share/doc/qt/qtassistant/qtassistant-remotecontrol-main-cpp.html
  • usr/share/doc/qt/qtassistant/qtassistant-remotecontrol-remotecontrol-cpp.html
  • usr/share/doc/qt/qtassistant/qtassistant-remotecontrol-remotecontrol-h.html
  • usr/share/doc/qt/qtassistant/qtassistant-remotecontrol-remotecontrol-pro.html
  • usr/share/doc/qt/qtassistant/qtassistant-remotecontrol-remotecontrol-qrc.html
  • usr/share/doc/qt/qtassistant/qtassistant-remotecontrol-remotecontrol-ui.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-assistant-cpp.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-assistant-h.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhcp.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhp.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-example.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-findfiledialog-cpp.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-findfiledialog-h.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-main-cpp.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-mainwindow-cpp.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-mainwindow-h.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-simpletextviewer-pro.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-textedit-cpp.html
  • usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-textedit-h.html
  • usr/share/doc/qt/qtassistant/qtassistant.index
  • usr/share/doc/qt/qtassistant/qtassistant.qhp
  • usr/share/doc/qt/qtassistant/qtassistant.qhp.sha1
  • usr/share/doc/qt/qtassistant/style/
  • usr/share/doc/qt/qtassistant/style/offline-simple.css
  • usr/share/doc/qt/qtassistant/style/offline.css
  • usr/share/doc/qt/qtbluetooth.qch
  • usr/share/doc/qt/qtbluetooth/
  • usr/share/doc/qt/qtbluetooth/bluetooth-examples.html
  • usr/share/doc/qt/qtbluetooth/examples-manifest.xml
  • usr/share/doc/qt/qtbluetooth/images/
  • usr/share/doc/qt/qtbluetooth/images/arrow_bc.png
  • usr/share/doc/qt/qtbluetooth/images/bgrContent.png
  • usr/share/doc/qt/qtbluetooth/images/btchat-example.png
  • usr/share/doc/qt/qtbluetooth/images/btfiletransfer-example.png
  • usr/share/doc/qt/qtbluetooth/images/btn_next.png
  • usr/share/doc/qt/qtbluetooth/images/btn_prev.png
  • usr/share/doc/qt/qtbluetooth/images/btscanner-example.png
  • usr/share/doc/qt/qtbluetooth/images/bullet_dn.png
  • usr/share/doc/qt/qtbluetooth/images/bullet_sq.png
  • usr/share/doc/qt/qtbluetooth/images/chat-view.png
  • usr/share/doc/qt/qtbluetooth/images/devicescan.png
  • usr/share/doc/qt/qtbluetooth/images/heartgame-result.png
  • usr/share/doc/qt/qtbluetooth/images/heartgame-running.png
  • usr/share/doc/qt/qtbluetooth/images/heartgame-search.png
  • usr/share/doc/qt/qtbluetooth/images/heartgame-start.png
  • usr/share/doc/qt/qtbluetooth/images/home.png
  • usr/share/doc/qt/qtbluetooth/images/ico_note.png
  • usr/share/doc/qt/qtbluetooth/images/ico_note_attention.png
  • usr/share/doc/qt/qtbluetooth/images/ico_out.png
  • usr/share/doc/qt/qtbluetooth/images/intro.png
  • usr/share/doc/qt/qtbluetooth/images/intro1.png
  • usr/share/doc/qt/qtbluetooth/images/logo.png
  • usr/share/doc/qt/qtbluetooth/images/lowenergyscanner-chars.png
  • usr/share/doc/qt/qtbluetooth/images/lowenergyscanner-devices.png
  • usr/share/doc/qt/qtbluetooth/images/lowenergyscanner-services.png
  • usr/share/doc/qt/qtbluetooth/images/opp-example-1.png
  • usr/share/doc/qt/qtbluetooth/images/opp-example-2.png
  • usr/share/doc/qt/qtbluetooth/images/opp-example-3.png
  • usr/share/doc/qt/qtbluetooth/images/peripheral-structure.png
  • usr/share/doc/qt/qtbluetooth/images/servicescan.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/btfiletransfer/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/btfiletransfer/busy.gif
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/btfiletransfer/pairing.gif
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/chat/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/chat/images/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/chat/images/clear.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/chat/images/default.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/chat/images/lineedit-bg.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/heartrate-game/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/heartrate-game/qml/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/bt_off_to_on.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/heart.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/logo.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/lowenergyscanner/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/lowenergyscanner/assets/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/lowenergyscanner/assets/busy_dark.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/picturetransfer/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/picturetransfer/background.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/picturetransfer/icon.png
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/scanner/
  • usr/share/doc/qt/qtbluetooth/images/used-in-examples/scanner/default.png
  • usr/share/doc/qt/qtbluetooth/qbluetooth.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothaddress-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothaddress.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothdevicediscoveryagent-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothdevicediscoveryagent-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothdevicediscoveryagent.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothdeviceinfo-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothdeviceinfo.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothhostinfo-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothhostinfo.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothlocaldevice-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothlocaldevice-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothlocaldevice.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserver-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserver-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserver.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothservicediscoveryagent-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothservicediscoveryagent-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothservicediscoveryagent.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-alternative-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-alternative.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-sequence-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-sequence.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothsocket-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothsocket-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothsocket.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothtransfermanager-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothtransfermanager-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothtransfermanager.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothtransferreply-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothtransferreply-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothtransferreply.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothtransferrequest-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothtransferrequest.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothuuid-members.html
  • usr/share/doc/qt/qtbluetooth/qbluetoothuuid.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingdata-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingdata.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingparameters-addressinfo-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingparameters-addressinfo.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingparameters-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingparameters.html
  • usr/share/doc/qt/qtbluetooth/qlowenergycharacteristic-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergycharacteristic.html
  • usr/share/doc/qt/qtbluetooth/qlowenergycharacteristicdata-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergycharacteristicdata.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyconnectionparameters-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyconnectionparameters.html
  • usr/share/doc/qt/qtbluetooth/qlowenergycontroller-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergycontroller-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qlowenergycontroller.html
  • usr/share/doc/qt/qtbluetooth/qlowenergydescriptor-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergydescriptor.html
  • usr/share/doc/qt/qtbluetooth/qlowenergydescriptordata-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergydescriptordata.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyservice-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyservice-obsolete.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyservice.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyservicedata-members.html
  • usr/share/doc/qt/qtbluetooth/qlowenergyservicedata.html
  • usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel-members.html
  • usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel.html
  • usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothservice-members.html
  • usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothservice.html
  • usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothsocket-members.html
  • usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothsocket.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-attribution-bluez.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-btchat-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-chat-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-chat-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-chat-ui.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-chatclient-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-chatclient-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-chatserver-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-chatserver-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-main-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-remoteselector-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-remoteselector-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-remoteselector-ui.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-qrc.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-main-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-ui.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-progress-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-progress-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-progress-ui.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-ui.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-btscanner-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-device-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-device-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-device-ui.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-main-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-service-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-service-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-service-ui.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-button-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-chat-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-chat-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-chat-qrc.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-inputbox-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-qmlchat-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-search-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-bluetoothbaseclass-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-bluetoothbaseclass-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-connectionhandler-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-connectionhandler-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-devicefinder-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-devicefinder-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-devicehandler-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-devicehandler-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-deviceinfo-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-deviceinfo-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-heartrate-game-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-heartrate-global-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-images-qrc.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-main-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-app-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-bluetoothalarmdialog-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-bottomline-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-connect-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-gamebutton-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-gamepage-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-gamesettings-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-main-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-measure-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-qmldir.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-qrc.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-splashscreen-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-stats-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-statslabel-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-qml-titlebar-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-server-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-server-heartrate-server-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-server-main-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-index.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-le-overview.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-assets-characteristics-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-assets-dialog-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-assets-header-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-assets-label-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-assets-main-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-assets-menu-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-assets-services-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-device-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-device-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-lowenergyscanner-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-main-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-resources-qrc.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-module.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-overview.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-bttransfer-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-button-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-devicediscovery-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-filesending-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-main-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-pictureselector-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-picturetransfer-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-qmltransfer-qrc.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-assets-board-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-assets-dialog-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-assets-main-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-assets-menu-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-main-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-pingpong-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-pingpong-h.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-pingpong-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-resource-qrc.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-qmlmodule.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-scanner-button-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-scanner-example.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-scanner-qmlscanner-cpp.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-scanner-scanner-pro.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-scanner-scanner-qml.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth-scanner-scanner-qrc.html
  • usr/share/doc/qt/qtbluetooth/qtbluetooth.index
  • usr/share/doc/qt/qtbluetooth/qtbluetooth.qhp
  • usr/share/doc/qt/qtbluetooth/qtbluetooth.qhp.sha1
  • usr/share/doc/qt/qtbluetooth/qtbluetooth.tags
  • usr/share/doc/qt/qtbluetooth/style/
  • usr/share/doc/qt/qtbluetooth/style/offline-simple.css
  • usr/share/doc/qt/qtbluetooth/style/offline.css
  • usr/share/doc/qt/qtcanvas3d.qch
  • usr/share/doc/qt/qtcanvas3d/
  • usr/share/doc/qt/qtcanvas3d/examples-manifest.xml
  • usr/share/doc/qt/qtcanvas3d/images/
  • usr/share/doc/qt/qtcanvas3d/images/arrow_bc.png
  • usr/share/doc/qt/qtcanvas3d/images/bgrContent.png
  • usr/share/doc/qt/qtcanvas3d/images/btn_next.png
  • usr/share/doc/qt/qtcanvas3d/images/btn_prev.png
  • usr/share/doc/qt/qtcanvas3d/images/bullet_dn.png
  • usr/share/doc/qt/qtcanvas3d/images/bullet_sq.png
  • usr/share/doc/qt/qtcanvas3d/images/cellphone-example.png
  • usr/share/doc/qt/qtcanvas3d/images/framebuffer-example.png
  • usr/share/doc/qt/qtcanvas3d/images/home.png
  • usr/share/doc/qt/qtcanvas3d/images/ico_note.png
  • usr/share/doc/qt/qtcanvas3d/images/ico_note_attention.png
  • usr/share/doc/qt/qtcanvas3d/images/ico_out.png
  • usr/share/doc/qt/qtcanvas3d/images/interaction-example.png
  • usr/share/doc/qt/qtcanvas3d/images/jsonmodels-example.png
  • usr/share/doc/qt/qtcanvas3d/images/logo.png
  • usr/share/doc/qt/qtcanvas3d/images/oneqt-example.png
  • usr/share/doc/qt/qtcanvas3d/images/planets-example.jpg
  • usr/share/doc/qt/qtcanvas3d/images/quickitemtexture-example.png
  • usr/share/doc/qt/qtcanvas3d/images/textureandlight-example.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/framebuffer/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/framebuffer/qml/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/framebuffer/qml/framebuffer/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/framebuffer/qml/framebuffer/qtlogo.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/interaction/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/interaction/qml/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/interaction/qml/interaction/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/interaction/qml/interaction/barrel.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/jsonmodels/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/jsonmodels/qml/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/bush.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/gold.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/pallet.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/rock.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/woodbox.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/textureandlight/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/textureandlight/qml/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/textureandlight/qml/textureandlight/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/textureandlight/qml/textureandlight/qtlogo.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/calendar.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/camera.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/clock.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/contacts.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/gallery.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/games.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/lock.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/mail.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/maps.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/menu_background.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/music.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/plutomap1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/qtlogo_with_alpha.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/settings.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/todo.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/videos.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29@2x.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40@2x.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon50x50@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon50x50~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon57x57.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon57x57@2x.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon60x60@2x.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon72x72@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon72x72~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon76x76@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon76x76~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/dataviz.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/devices.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/embedded.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/iot.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/multiscreen.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/puzzle-pieces.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/qtlogo.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/qtlogosmall.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/earth.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthbump1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthcloudmapcolortrans.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthmap1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthspec1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/galaxy_starfield.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupiter.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupitermap.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/mars.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsbump1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsmap1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercury.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurybump.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurymap.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonbump1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonmap1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptune.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptunemap.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutobump1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutomap1k.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturn.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnmap.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnringcolortrans.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/sun.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/sunmap.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranus.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusmap.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusringcolortrans.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/venus.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusbump.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusmap.jpg
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29@2x.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40@2x.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon50x50@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon50x50~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon57x57.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon57x57@2x.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon60x60@2x.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon72x72@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon72x72~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon76x76@2x~ipad.png
  • usr/share/doc/qt/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon76x76~ipad.png
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3d-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3d.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dshader-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dshader.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-context3d-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-context3d.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-glstatedumpext-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-glstatedumpext.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-textureimage-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-textureimage.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-textureimagefactory-members.html
  • usr/share/doc/qt/qtcanvas3d/qml-qtcanvas3d-textureimagefactory.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-conformance-issues-html.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-examples.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-framebuffer-example.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-pro.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-qrc.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-framebuffer-main-cpp.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-framebuffer-js.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-main-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-getting-started.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-index.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-interaction-example.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-interaction-interaction-pro.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-interaction-interaction-qrc.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-interaction-main-cpp.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-interaction-js.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-main-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-jsonmodels-example.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-jsonmodels-jsonmodels-pro.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-jsonmodels-main-cpp.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-js.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-jsonmodels-qml-qrc.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-logging.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-qmlmodule-obsolete.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-quickitemtexture-example.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-quickitemtexture-main-cpp.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-main-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-quickitemtexture-js.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-pro.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-qrc.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-textureandlight-example.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-textureandlight-main-cpp.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-main-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-textureandlight-js.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-pro.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-qrc.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-pro.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-qrc.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-example.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-main-cpp.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphone-js.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphoneapp-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphonecanvas-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-colorselector-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-fpsdisplay-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-main-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-example.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-js.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-infosheet-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-main-cpp.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-navibutton-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-pro.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qrc.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-oneqt-swipearea-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-example.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-fpsdisplay-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-infosheet-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-main-cpp.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-planetbutton-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-planets-js.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-planets-pro.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qrc.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d-threejs-planets-styledslider-qml.html
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d.index
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d.qhp
  • usr/share/doc/qt/qtcanvas3d/qtcanvas3d.qhp.sha1
  • usr/share/doc/qt/qtcanvas3d/style/
  • usr/share/doc/qt/qtcanvas3d/style/offline-simple.css
  • usr/share/doc/qt/qtcanvas3d/style/offline.css
  • usr/share/doc/qt/qtcharts.qch
  • usr/share/doc/qt/qtcharts/
  • usr/share/doc/qt/qtcharts/examples-manifest.xml
  • usr/share/doc/qt/qtcharts/images/
  • usr/share/doc/qt/qtcharts/images/api_category_axis.png
  • usr/share/doc/qt/qtcharts/images/api_datatime_axis.png
  • usr/share/doc/qt/qtcharts/images/arrow_bc.png
  • usr/share/doc/qt/qtcharts/images/bgrContent.png
  • usr/share/doc/qt/qtcharts/images/btn_next.png
  • usr/share/doc/qt/qtcharts/images/btn_prev.png
  • usr/share/doc/qt/qtcharts/images/bullet_dn.png
  • usr/share/doc/qt/qtcharts/images/bullet_sq.png
  • usr/share/doc/qt/qtcharts/images/examples_areachart.png
  • usr/share/doc/qt/qtcharts/images/examples_audio.png
  • usr/share/doc/qt/qtcharts/images/examples_barchart.png
  • usr/share/doc/qt/qtcharts/images/examples_barmodelmapper.png
  • usr/share/doc/qt/qtcharts/images/examples_boxplotchart.png
  • usr/share/doc/qt/qtcharts/images/examples_callout.png
  • usr/share/doc/qt/qtcharts/images/examples_candlestickchart.png
  • usr/share/doc/qt/qtcharts/images/examples_chartthemes_blue_cerulean.png
  • usr/share/doc/qt/qtcharts/images/examples_chartthemes_brown_sand.png
  • usr/share/doc/qt/qtcharts/images/examples_chartthemes_light.png
  • usr/share/doc/qt/qtcharts/images/examples_customchart.png
  • usr/share/doc/qt/qtcharts/images/examples_datetimeaxis.png
  • usr/share/doc/qt/qtcharts/images/examples_donutbreakdown.png
  • usr/share/doc/qt/qtcharts/images/examples_donutchart.png
  • usr/share/doc/qt/qtcharts/images/examples_dynamicspline1.png
  • usr/share/doc/qt/qtcharts/images/examples_dynamicspline2.png
  • usr/share/doc/qt/qtcharts/images/examples_horizontalbarchart.png
  • usr/share/doc/qt/qtcharts/images/examples_horizontalpercentbarchart.png
  • usr/share/doc/qt/qtcharts/images/examples_horizontalstackedbarchart.png
  • usr/share/doc/qt/qtcharts/images/examples_legend_detach.png
  • usr/share/doc/qt/qtcharts/images/examples_legend_detach2.png
  • usr/share/doc/qt/qtcharts/images/examples_legendmarkers.png
  • usr/share/doc/qt/qtcharts/images/examples_lineandbar.png
  • usr/share/doc/qt/qtcharts/images/examples_linechart.png
  • usr/share/doc/qt/qtcharts/images/examples_logvalueaxis.png
  • usr/share/doc/qt/qtcharts/images/examples_modeldata.png
  • usr/share/doc/qt/qtcharts/images/examples_multiaxis.png
  • usr/share/doc/qt/qtcharts/images/examples_nesteddonuts.png
  • usr/share/doc/qt/qtcharts/images/examples_openglseries.png
  • usr/share/doc/qt/qtcharts/images/examples_percentbarchart.png
  • usr/share/doc/qt/qtcharts/images/examples_percentbarchart_legend.png
  • usr/share/doc/qt/qtcharts/images/examples_piechart.png
  • usr/share/doc/qt/qtcharts/images/examples_piechartdrill1.png
  • usr/share/doc/qt/qtcharts/images/examples_piechartdrill2.png
  • usr/share/doc/qt/qtcharts/images/examples_polarchart.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlaxes1.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlaxes2.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlaxes3.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlboxplot.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlcandlestick.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart1.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart10.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart11.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart12.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart2.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart3.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart4.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart5.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart6.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart7.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart8.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlchart9.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlcustomizations.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlcustomlegend1.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlcustomlegend2.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlcustomlegend3.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlf1legends.png
  • usr/share/doc/qt/qtcharts/images/examples_qmloscilloscope.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlpiechart.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlpolarchart1.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlpolarchart2.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlpolarchart3.png
  • usr/share/doc/qt/qtcharts/images/examples_qmlweather.png
  • usr/share/doc/qt/qtcharts/images/examples_scatterchart.png
  • usr/share/doc/qt/qtcharts/images/examples_scatterinteractions.png
  • usr/share/doc/qt/qtcharts/images/examples_splinechart.png
  • usr/share/doc/qt/qtcharts/images/examples_stackedbarchart.png
  • usr/share/doc/qt/qtcharts/images/examples_stackedbarchartdrilldown1.png
  • usr/share/doc/qt/qtcharts/images/examples_stackedbarchartdrilldown2.png
  • usr/share/doc/qt/qtcharts/images/examples_temperaturerecords.png
  • usr/share/doc/qt/qtcharts/images/examples_zoomlinechart1.png
  • usr/share/doc/qt/qtcharts/images/examples_zoomlinechart2.png
  • usr/share/doc/qt/qtcharts/images/home.png
  • usr/share/doc/qt/qtcharts/images/ico_note.png
  • usr/share/doc/qt/qtcharts/images/ico_note_attention.png
  • usr/share/doc/qt/qtcharts/images/ico_out.png
  • usr/share/doc/qt/qtcharts/images/logo.png
  • usr/share/doc/qt/qtcharts/images/piechart_customization.png
  • usr/share/doc/qt/qtcharts/qabstractaxis-members.html
  • usr/share/doc/qt/qtcharts/qabstractaxis-obsolete.html
  • usr/share/doc/qt/qtcharts/qabstractaxis.html
  • usr/share/doc/qt/qtcharts/qabstractbarseries-members.html
  • usr/share/doc/qt/qtcharts/qabstractbarseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qabstractbarseries.html
  • usr/share/doc/qt/qtcharts/qabstractseries-members.html
  • usr/share/doc/qt/qtcharts/qabstractseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qabstractseries.html
  • usr/share/doc/qt/qtcharts/qarealegendmarker-members.html
  • usr/share/doc/qt/qtcharts/qarealegendmarker-obsolete.html
  • usr/share/doc/qt/qtcharts/qarealegendmarker.html
  • usr/share/doc/qt/qtcharts/qareaseries-members.html
  • usr/share/doc/qt/qtcharts/qareaseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qareaseries.html
  • usr/share/doc/qt/qtcharts/qbarcategoryaxis-members.html
  • usr/share/doc/qt/qtcharts/qbarcategoryaxis-obsolete.html
  • usr/share/doc/qt/qtcharts/qbarcategoryaxis.html
  • usr/share/doc/qt/qtcharts/qbarlegendmarker-members.html
  • usr/share/doc/qt/qtcharts/qbarlegendmarker-obsolete.html
  • usr/share/doc/qt/qtcharts/qbarlegendmarker.html
  • usr/share/doc/qt/qtcharts/qbarseries-members.html
  • usr/share/doc/qt/qtcharts/qbarseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qbarseries.html
  • usr/share/doc/qt/qtcharts/qbarset-members.html
  • usr/share/doc/qt/qtcharts/qbarset-obsolete.html
  • usr/share/doc/qt/qtcharts/qbarset.html
  • usr/share/doc/qt/qtcharts/qboxplotlegendmarker-members.html
  • usr/share/doc/qt/qtcharts/qboxplotlegendmarker-obsolete.html
  • usr/share/doc/qt/qtcharts/qboxplotlegendmarker.html
  • usr/share/doc/qt/qtcharts/qboxplotseries-members.html
  • usr/share/doc/qt/qtcharts/qboxplotseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qboxplotseries.html
  • usr/share/doc/qt/qtcharts/qboxset-members.html
  • usr/share/doc/qt/qtcharts/qboxset-obsolete.html
  • usr/share/doc/qt/qtcharts/qboxset.html
  • usr/share/doc/qt/qtcharts/qcandlesticklegendmarker-members.html
  • usr/share/doc/qt/qtcharts/qcandlesticklegendmarker-obsolete.html
  • usr/share/doc/qt/qtcharts/qcandlesticklegendmarker.html
  • usr/share/doc/qt/qtcharts/qcandlestickmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qcandlestickmodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qcandlestickmodelmapper.html
  • usr/share/doc/qt/qtcharts/qcandlestickseries-members.html
  • usr/share/doc/qt/qtcharts/qcandlestickseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qcandlestickseries.html
  • usr/share/doc/qt/qtcharts/qcandlestickset-members.html
  • usr/share/doc/qt/qtcharts/qcandlestickset-obsolete.html
  • usr/share/doc/qt/qtcharts/qcandlestickset.html
  • usr/share/doc/qt/qtcharts/qcategoryaxis-members.html
  • usr/share/doc/qt/qtcharts/qcategoryaxis-obsolete.html
  • usr/share/doc/qt/qtcharts/qcategoryaxis.html
  • usr/share/doc/qt/qtcharts/qchart-members.html
  • usr/share/doc/qt/qtcharts/qchart-obsolete.html
  • usr/share/doc/qt/qtcharts/qchart.html
  • usr/share/doc/qt/qtcharts/qchartview-members.html
  • usr/share/doc/qt/qtcharts/qchartview-obsolete.html
  • usr/share/doc/qt/qtcharts/qchartview.html
  • usr/share/doc/qt/qtcharts/qdatetimeaxis-members.html
  • usr/share/doc/qt/qtcharts/qdatetimeaxis-obsolete.html
  • usr/share/doc/qt/qtcharts/qdatetimeaxis.html
  • usr/share/doc/qt/qtcharts/qhbarmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qhbarmodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qhbarmodelmapper.html
  • usr/share/doc/qt/qtcharts/qhboxplotmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qhboxplotmodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qhboxplotmodelmapper.html
  • usr/share/doc/qt/qtcharts/qhcandlestickmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qhcandlestickmodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qhcandlestickmodelmapper.html
  • usr/share/doc/qt/qtcharts/qhorizontalbarseries-members.html
  • usr/share/doc/qt/qtcharts/qhorizontalbarseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qhorizontalbarseries.html
  • usr/share/doc/qt/qtcharts/qhorizontalpercentbarseries-members.html
  • usr/share/doc/qt/qtcharts/qhorizontalpercentbarseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qhorizontalpercentbarseries.html
  • usr/share/doc/qt/qtcharts/qhorizontalstackedbarseries-members.html
  • usr/share/doc/qt/qtcharts/qhorizontalstackedbarseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qhorizontalstackedbarseries.html
  • usr/share/doc/qt/qtcharts/qhpiemodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qhpiemodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qhpiemodelmapper.html
  • usr/share/doc/qt/qtcharts/qhxymodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qhxymodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qhxymodelmapper.html
  • usr/share/doc/qt/qtcharts/qlegend-members.html
  • usr/share/doc/qt/qtcharts/qlegend-obsolete.html
  • usr/share/doc/qt/qtcharts/qlegend.html
  • usr/share/doc/qt/qtcharts/qlegendmarker-members.html
  • usr/share/doc/qt/qtcharts/qlegendmarker-obsolete.html
  • usr/share/doc/qt/qtcharts/qlegendmarker.html
  • usr/share/doc/qt/qtcharts/qlineseries-members.html
  • usr/share/doc/qt/qtcharts/qlineseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qlineseries.html
  • usr/share/doc/qt/qtcharts/qlogvalueaxis-members.html
  • usr/share/doc/qt/qtcharts/qlogvalueaxis-obsolete.html
  • usr/share/doc/qt/qtcharts/qlogvalueaxis.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-abstractaxis-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-abstractaxis.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-abstractbarseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-abstractbarseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-abstractseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-abstractseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-areaseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-areaseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-barcategoryaxis-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-barcategoryaxis.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-barseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-barseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-barset-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-barset.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-boxplotseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-boxplotseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-boxset-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-boxset.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-candlestickseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-candlestickseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-candlestickset-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-candlestickset.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-categoryaxis-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-categoryaxis.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-categoryrange-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-categoryrange.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-chartview-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-chartview.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-datetimeaxis-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-datetimeaxis.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hbarmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hbarmodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hboxplotmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hboxplotmodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hcandlestickmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hcandlestickmodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalbarseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalbarseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalpercentbarseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalpercentbarseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalstackedbarseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalstackedbarseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hpiemodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hpiemodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hxymodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-hxymodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-legend-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-legend.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-lineseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-lineseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-logvalueaxis-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-logvalueaxis.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-margins-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-margins.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-percentbarseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-percentbarseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-pieseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-pieseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-pieslice-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-pieslice.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-polarchartview-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-polarchartview.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-scatterseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-scatterseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-splineseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-splineseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-stackedbarseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-stackedbarseries.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-valueaxis-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-valueaxis.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vbarmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vbarmodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vboxplotmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vboxplotmodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vcandlestickmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vcandlestickmodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vpiemodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vpiemodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vxymodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-vxymodelmapper.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-xypoint-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-xypoint.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-xyseries-members.html
  • usr/share/doc/qt/qtcharts/qml-qtcharts-xyseries.html
  • usr/share/doc/qt/qtcharts/qpercentbarseries-members.html
  • usr/share/doc/qt/qtcharts/qpercentbarseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qpercentbarseries.html
  • usr/share/doc/qt/qtcharts/qpielegendmarker-members.html
  • usr/share/doc/qt/qtcharts/qpielegendmarker-obsolete.html
  • usr/share/doc/qt/qtcharts/qpielegendmarker.html
  • usr/share/doc/qt/qtcharts/qpieseries-members.html
  • usr/share/doc/qt/qtcharts/qpieseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qpieseries.html
  • usr/share/doc/qt/qtcharts/qpieslice-members.html
  • usr/share/doc/qt/qtcharts/qpieslice-obsolete.html
  • usr/share/doc/qt/qtcharts/qpieslice.html
  • usr/share/doc/qt/qtcharts/qpolarchart-members.html
  • usr/share/doc/qt/qtcharts/qpolarchart-obsolete.html
  • usr/share/doc/qt/qtcharts/qpolarchart.html
  • usr/share/doc/qt/qtcharts/qscatterseries-members.html
  • usr/share/doc/qt/qtcharts/qscatterseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qscatterseries.html
  • usr/share/doc/qt/qtcharts/qsplineseries-members.html
  • usr/share/doc/qt/qtcharts/qsplineseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qsplineseries.html
  • usr/share/doc/qt/qtcharts/qstackedbarseries-members.html
  • usr/share/doc/qt/qtcharts/qstackedbarseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qstackedbarseries.html
  • usr/share/doc/qt/qtcharts/qtcharts-areachart-areachart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-areachart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-areachart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-audio-audio-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-audio-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-audio-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-audio-widget-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-audio-widget-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-audio-xyseriesiodevice-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-audio-xyseriesiodevice-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-barchart-barchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-barchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-barchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-barmodelmapper-barmodelmapper-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-barmodelmapper-customtablemodel-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-barmodelmapper-customtablemodel-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-barmodelmapper-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-barmodelmapper-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-barmodelmapper-tablewidget-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-barmodelmapper-tablewidget-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-boxplotchart-boxdatareader-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-boxplotchart-boxdatareader-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-boxplotchart-boxplotchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-boxplotchart-boxplotdata-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-boxplotchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-boxplotchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-callout-callout-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-callout-callout-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-callout-callout-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-callout-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-callout-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-callout-view-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-callout-view-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-candlestickchart-candlestickchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-candlestickchart-candlestickdata-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-candlestickchart-candlestickdatareader-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-candlestickchart-candlestickdatareader-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-candlestickchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-candlestickchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-chartthemes-chartthemes-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-chartthemes-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-chartthemes-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-chartthemes-themewidget-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-chartthemes-themewidget-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-chartthemes-themewidget-ui.html
  • usr/share/doc/qt/qtcharts/qtcharts-customchart-customchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-customchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-customchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-datetimeaxis-datetimeaxis-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-datetimeaxis-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-datetimeaxis-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-datetimeaxis-sundata-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutbreakdown-donutbreakdown-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutbreakdown-donutbreakdownchart-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutbreakdown-donutbreakdownchart-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutbreakdown-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutbreakdown-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutbreakdown-mainslice-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutbreakdown-mainslice-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutchart-donutchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-donutchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-dynamicspline-chart-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-dynamicspline-chart-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-dynamicspline-dynamicspline-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-dynamicspline-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-dynamicspline-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-examples.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalbarchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalbarchart-horizontalbarchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalbarchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalpercentbarchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalpercentbarchart-horizontalpercentbarchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalpercentbarchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalstackedbarchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalstackedbarchart-horizontalstackedbarchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-horizontalstackedbarchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-index.html
  • usr/share/doc/qt/qtcharts/qtcharts-legend-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-legend-legend-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-legend-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-legend-mainwidget-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-legend-mainwidget-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-legendmarkers-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-legendmarkers-legendmarkers-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-legendmarkers-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-legendmarkers-mainwidget-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-legendmarkers-mainwidget-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-lineandbar-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-lineandbar-lineandbar-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-lineandbar-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-linechart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-linechart-linechart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-linechart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-logvalueaxis-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-logvalueaxis-logvalueaxis-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-logvalueaxis-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-modeldata-customtablemodel-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-modeldata-customtablemodel-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-modeldata-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-modeldata-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-modeldata-modeldata-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-modeldata-tablewidget-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-modeldata-tablewidget-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-module.html
  • usr/share/doc/qt/qtcharts/qtcharts-multiaxis-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-multiaxis-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-multiaxis-multiaxis-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-nesteddonuts-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-nesteddonuts-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-nesteddonuts-nesteddonuts-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-nesteddonuts-widget-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-nesteddonuts-widget-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-openglseries-datasource-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-openglseries-datasource-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-openglseries-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-openglseries-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-openglseries-openglseries-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-overview.html
  • usr/share/doc/qt/qtcharts/qtcharts-percentbarchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-percentbarchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-percentbarchart-percentbarchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechart-piechart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-brushtool-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-brushtool-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-customslice-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-customslice-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-mainwidget-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-mainwidget-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-pentool-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-pentool-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-piechartcustomization-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartdrilldown-drilldownchart-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartdrilldown-drilldownchart-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartdrilldown-drilldownslice-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartdrilldown-drilldownslice-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartdrilldown-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartdrilldown-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-piechartdrilldown-piechartdrilldown-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-polarchart-chartview-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-polarchart-chartview-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-polarchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-polarchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-polarchart-polarchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-qml-qmlaxes-main-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-qml-qmlaxes-view1-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-qml-qmlaxes-view2-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-qml-qmlaxes-view3-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-qmlaxes-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-resources-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-main-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-mainform-ui-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view1-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view10-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view11-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view12-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view2-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view3-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view4-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view5-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view6-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view7-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view8-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qml-qmlchart-view9-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-qmlchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlchart-resources-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomizations-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomizations-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomizations-qml-qmlcustomizations-main-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomizations-qmlcustomizations-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomizations-resources-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-animatedareaseries-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewhighlighted-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewselector-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewstacked-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-customlegend-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-main-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-qmlcustomlegend-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-resources-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlf1legends-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlf1legends-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlf1legends-qml-qmlf1legends-main-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlf1legends-qml-qmlf1legends-speedsxml-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlf1legends-qmlf1legends-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlf1legends-resources-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlmodule.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-datasource-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-datasource-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-qml-qmloscilloscope-controlpanel-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-qml-qmloscilloscope-main-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-qml-qmloscilloscope-multibutton-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-qml-qmloscilloscope-scopeview-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-qmloscilloscope-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-resources-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-qml-qmlpolarchart-main-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-qml-qmlpolarchart-view1-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-qml-qmlpolarchart-view2-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-qml-qmlpolarchart-view3-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-qmlpolarchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-resources-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlweather-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlweather-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlweather-qml-qmlweather-main-qml.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlweather-qmlweather-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-qmlweather-resources-qrc.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterchart-chartview-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterchart-chartview-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterchart-scatterchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterinteractions-chartview-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterinteractions-chartview-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterinteractions-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterinteractions-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-scatterinteractions-scatterinteractions-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-splinechart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-splinechart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-splinechart-splinechart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchart-stackedbarchart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchartdrilldown-drilldownchart-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchartdrilldown-drilldownchart-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchartdrilldown-drilldownseries-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchartdrilldown-drilldownseries-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchartdrilldown-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchartdrilldown-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-stackedbarchartdrilldown-stackedbarchartdrilldown-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-temperaturerecords-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-temperaturerecords-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-temperaturerecords-temperaturerecords-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts-zoomlinechart-chart-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-zoomlinechart-chart-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-zoomlinechart-chartview-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-zoomlinechart-chartview-h.html
  • usr/share/doc/qt/qtcharts/qtcharts-zoomlinechart-example.html
  • usr/share/doc/qt/qtcharts/qtcharts-zoomlinechart-main-cpp.html
  • usr/share/doc/qt/qtcharts/qtcharts-zoomlinechart-zoomlinechart-pro.html
  • usr/share/doc/qt/qtcharts/qtcharts.index
  • usr/share/doc/qt/qtcharts/qtcharts.qhp
  • usr/share/doc/qt/qtcharts/qtcharts.qhp.sha1
  • usr/share/doc/qt/qtcharts/qvalueaxis-members.html
  • usr/share/doc/qt/qtcharts/qvalueaxis-obsolete.html
  • usr/share/doc/qt/qtcharts/qvalueaxis.html
  • usr/share/doc/qt/qtcharts/qvbarmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qvbarmodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qvbarmodelmapper.html
  • usr/share/doc/qt/qtcharts/qvboxplotmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qvboxplotmodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qvboxplotmodelmapper.html
  • usr/share/doc/qt/qtcharts/qvcandlestickmodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qvcandlestickmodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qvcandlestickmodelmapper.html
  • usr/share/doc/qt/qtcharts/qvpiemodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qvpiemodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qvpiemodelmapper.html
  • usr/share/doc/qt/qtcharts/qvxymodelmapper-members.html
  • usr/share/doc/qt/qtcharts/qvxymodelmapper-obsolete.html
  • usr/share/doc/qt/qtcharts/qvxymodelmapper.html
  • usr/share/doc/qt/qtcharts/qxylegendmarker-members.html
  • usr/share/doc/qt/qtcharts/qxylegendmarker-obsolete.html
  • usr/share/doc/qt/qtcharts/qxylegendmarker.html
  • usr/share/doc/qt/qtcharts/qxyseries-members.html
  • usr/share/doc/qt/qtcharts/qxyseries-obsolete.html
  • usr/share/doc/qt/qtcharts/qxyseries.html
  • usr/share/doc/qt/qtcharts/style/
  • usr/share/doc/qt/qtcharts/style/offline-simple.css
  • usr/share/doc/qt/qtcharts/style/offline.css
  • usr/share/doc/qt/qtconcurrent.qch
  • usr/share/doc/qt/qtconcurrent/
  • usr/share/doc/qt/qtconcurrent/examples-manifest.xml
  • usr/share/doc/qt/qtconcurrent/images/
  • usr/share/doc/qt/qtconcurrent/images/arrow_bc.png
  • usr/share/doc/qt/qtconcurrent/images/bgrContent.png
  • usr/share/doc/qt/qtconcurrent/images/btn_next.png
  • usr/share/doc/qt/qtconcurrent/images/btn_prev.png
  • usr/share/doc/qt/qtconcurrent/images/bullet_dn.png
  • usr/share/doc/qt/qtconcurrent/images/bullet_sq.png
  • usr/share/doc/qt/qtconcurrent/images/home.png
  • usr/share/doc/qt/qtconcurrent/images/ico_note.png
  • usr/share/doc/qt/qtconcurrent/images/ico_note_attention.png
  • usr/share/doc/qt/qtconcurrent/images/ico_out.png
  • usr/share/doc/qt/qtconcurrent/images/imagescaling_example.png
  • usr/share/doc/qt/qtconcurrent/images/logo.png
  • usr/share/doc/qt/qtconcurrent/images/qtconcurrent-progressdialog.png
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-imagescaling-example.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-imagescaling-imagescaling-cpp.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-imagescaling-imagescaling-h.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-imagescaling-imagescaling-pro.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-imagescaling-main-cpp.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-index.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-map-example.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-map-main-cpp.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-map-map-pro.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-module.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-progressdialog-example.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-progressdialog-main-cpp.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-progressdialog-progressdialog-pro.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-runfunction-example.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-runfunction-main-cpp.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-runfunction-runfunction-pro.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-wordcount-example.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-wordcount-main-cpp.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent-wordcount-wordcount-pro.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrent.index
  • usr/share/doc/qt/qtconcurrent/qtconcurrent.qhp
  • usr/share/doc/qt/qtconcurrent/qtconcurrent.qhp.sha1
  • usr/share/doc/qt/qtconcurrent/qtconcurrent.tags
  • usr/share/doc/qt/qtconcurrent/qtconcurrentfilter.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrentmap.html
  • usr/share/doc/qt/qtconcurrent/qtconcurrentrun.html
  • usr/share/doc/qt/qtconcurrent/style/
  • usr/share/doc/qt/qtconcurrent/style/offline-simple.css
  • usr/share/doc/qt/qtconcurrent/style/offline.css
  • usr/share/doc/qt/qtcore.qch
  • usr/share/doc/qt/qtcore/
  • usr/share/doc/qt/qtcore/animation-overview.html
  • usr/share/doc/qt/qtcore/animation.html
  • usr/share/doc/qt/qtcore/codec-big5.html
  • usr/share/doc/qt/qtcore/codec-big5hkscs.html
  • usr/share/doc/qt/qtcore/codec-eucjp.html
  • usr/share/doc/qt/qtcore/codec-euckr.html
  • usr/share/doc/qt/qtcore/codec-gbk.html
  • usr/share/doc/qt/qtcore/codec-sjis.html
  • usr/share/doc/qt/qtcore/codec-tscii.html
  • usr/share/doc/qt/qtcore/codecs-jis.html
  • usr/share/doc/qt/qtcore/containers.html
  • usr/share/doc/qt/qtcore/custom-types.html
  • usr/share/doc/qt/qtcore/datastreamformat.html
  • usr/share/doc/qt/qtcore/events.html
  • usr/share/doc/qt/qtcore/eventsandfilters.html
  • usr/share/doc/qt/qtcore/examples-manifest.xml
  • usr/share/doc/qt/qtcore/images/
  • usr/share/doc/qt/qtcore/images/abstract-connections.png
  • usr/share/doc/qt/qtcore/images/animations-architecture.png
  • usr/share/doc/qt/qtcore/images/arrow_bc.png
  • usr/share/doc/qt/qtcore/images/bgrContent.png
  • usr/share/doc/qt/qtcore/images/brush-styles.png
  • usr/share/doc/qt/qtcore/images/btn_next.png
  • usr/share/doc/qt/qtcore/images/btn_prev.png
  • usr/share/doc/qt/qtcore/images/bullet_dn.png
  • usr/share/doc/qt/qtcore/images/bullet_sq.png
  • usr/share/doc/qt/qtcore/images/cursor-arrow.png
  • usr/share/doc/qt/qtcore/images/cursor-busy.png
  • usr/share/doc/qt/qtcore/images/cursor-closedhand.png
  • usr/share/doc/qt/qtcore/images/cursor-cross.png
  • usr/share/doc/qt/qtcore/images/cursor-forbidden.png
  • usr/share/doc/qt/qtcore/images/cursor-hand.png
  • usr/share/doc/qt/qtcore/images/cursor-hsplit.png
  • usr/share/doc/qt/qtcore/images/cursor-ibeam.png
  • usr/share/doc/qt/qtcore/images/cursor-openhand.png
  • usr/share/doc/qt/qtcore/images/cursor-sizeall.png
  • usr/share/doc/qt/qtcore/images/cursor-sizeb.png
  • usr/share/doc/qt/qtcore/images/cursor-sizef.png
  • usr/share/doc/qt/qtcore/images/cursor-sizeh.png
  • usr/share/doc/qt/qtcore/images/cursor-sizev.png
  • usr/share/doc/qt/qtcore/images/cursor-uparrow.png
  • usr/share/doc/qt/qtcore/images/cursor-vsplit.png
  • usr/share/doc/qt/qtcore/images/cursor-wait.png
  • usr/share/doc/qt/qtcore/images/cursor-whatsthis.png
  • usr/share/doc/qt/qtcore/images/home.png
  • usr/share/doc/qt/qtcore/images/ico_note.png
  • usr/share/doc/qt/qtcore/images/ico_note_attention.png
  • usr/share/doc/qt/qtcore/images/ico_out.png
  • usr/share/doc/qt/qtcore/images/javaiterators1.png
  • usr/share/doc/qt/qtcore/images/javaiterators2.png
  • usr/share/doc/qt/qtcore/images/localfortuneclient-example.png
  • usr/share/doc/qt/qtcore/images/localfortuneserver-example.png
  • usr/share/doc/qt/qtcore/images/logo.png
  • usr/share/doc/qt/qtcore/images/mandelbrot-example.png
  • usr/share/doc/qt/qtcore/images/mandelbrot_scroll1.png
  • usr/share/doc/qt/qtcore/images/mandelbrot_scroll2.png
  • usr/share/doc/qt/qtcore/images/mandelbrot_scroll3.png
  • usr/share/doc/qt/qtcore/images/mandelbrot_zoom1.png
  • usr/share/doc/qt/qtcore/images/mandelbrot_zoom2.png
  • usr/share/doc/qt/qtcore/images/mandelbrot_zoom3.png
  • usr/share/doc/qt/qtcore/images/mimetypebrowser.png
  • usr/share/doc/qt/qtcore/images/modelindex-no-parent.png
  • usr/share/doc/qt/qtcore/images/modelview-begin-append-columns.png
  • usr/share/doc/qt/qtcore/images/modelview-begin-append-rows.png
  • usr/share/doc/qt/qtcore/images/modelview-begin-insert-columns.png
  • usr/share/doc/qt/qtcore/images/modelview-begin-insert-rows.png
  • usr/share/doc/qt/qtcore/images/modelview-begin-remove-columns.png
  • usr/share/doc/qt/qtcore/images/modelview-begin-remove-rows.png
  • usr/share/doc/qt/qtcore/images/modelview-move-rows-1.png
  • usr/share/doc/qt/qtcore/images/modelview-move-rows-2.png
  • usr/share/doc/qt/qtcore/images/modelview-move-rows-3.png
  • usr/share/doc/qt/qtcore/images/modelview-move-rows-4.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inback.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inbounce.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-incirc.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-incubic.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inelastic.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inexpo.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutback.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutbounce.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutcirc.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutcubic.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutelastic.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutexpo.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutquad.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutquart.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutquint.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inoutsine.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inquad.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inquart.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-inquint.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-insine.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-linear.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outback.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outbounce.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outcirc.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outcubic.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outelastic.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outexpo.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outinback.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outinbounce.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outincirc.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outincubic.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outinelastic.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outinexpo.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outinquad.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outinquart.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outinquint.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outinsine.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outquad.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outquart.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outquint.png
  • usr/share/doc/qt/qtcore/images/qeasingcurve-outsine.png
  • usr/share/doc/qt/qtcore/images/qimage-scaling.png
  • usr/share/doc/qt/qtcore/images/qline-coordinates.png
  • usr/share/doc/qt/qtcore/images/qline-point.png
  • usr/share/doc/qt/qtcore/images/qlinef-angle-identicaldirection.png
  • usr/share/doc/qt/qtcore/images/qlinef-angle-oppositedirection.png
  • usr/share/doc/qt/qtcore/images/qlinef-bounded.png
  • usr/share/doc/qt/qtcore/images/qlinef-normalvector.png
  • usr/share/doc/qt/qtcore/images/qlinef-unbounded.png
  • usr/share/doc/qt/qtcore/images/qpen-bevel.png
  • usr/share/doc/qt/qtcore/images/qpen-custom.png
  • usr/share/doc/qt/qtcore/images/qpen-dash.png
  • usr/share/doc/qt/qtcore/images/qpen-dashdot.png
  • usr/share/doc/qt/qtcore/images/qpen-dashdotdot.png
  • usr/share/doc/qt/qtcore/images/qpen-dot.png
  • usr/share/doc/qt/qtcore/images/qpen-flat.png
  • usr/share/doc/qt/qtcore/images/qpen-miter.png
  • usr/share/doc/qt/qtcore/images/qpen-roundcap.png
  • usr/share/doc/qt/qtcore/images/qpen-roundjoin.png
  • usr/share/doc/qt/qtcore/images/qpen-solid.png
  • usr/share/doc/qt/qtcore/images/qpen-square.png
  • usr/share/doc/qt/qtcore/images/qrect-coordinates.png
  • usr/share/doc/qt/qtcore/images/qrect-diagram-one.png
  • usr/share/doc/qt/qtcore/images/qrect-diagram-three.png
  • usr/share/doc/qt/qtcore/images/qrect-diagram-two.png
  • usr/share/doc/qt/qtcore/images/qrect-diagram-zero.png
  • usr/share/doc/qt/qtcore/images/qrect-intersect.png
  • usr/share/doc/qt/qtcore/images/qrect-unite.png
  • usr/share/doc/qt/qtcore/images/qrectf-coordinates.png
  • usr/share/doc/qt/qtcore/images/qrectf-diagram-one.png
  • usr/share/doc/qt/qtcore/images/qrectf-diagram-three.png
  • usr/share/doc/qt/qtcore/images/qrectf-diagram-two.png
  • usr/share/doc/qt/qtcore/images/qsortfilterproxymodel-sorting.png
  • usr/share/doc/qt/qtcore/images/queuedcustomtype-example.png
  • usr/share/doc/qt/qtcore/images/qurl-authority.png
  • usr/share/doc/qt/qtcore/images/qurl-authority2.png
  • usr/share/doc/qt/qtcore/images/qurl-authority3.png
  • usr/share/doc/qt/qtcore/images/qurl-fragment.png
  • usr/share/doc/qt/qtcore/images/qurl-ftppath.png
  • usr/share/doc/qt/qtcore/images/qurl-mailtopath.png
  • usr/share/doc/qt/qtcore/images/qurl-querystring.png
  • usr/share/doc/qt/qtcore/images/resources.png
  • usr/share/doc/qt/qtcore/images/sharedmemory-example_1.png
  • usr/share/doc/qt/qtcore/images/sharedmemory-example_2.png
  • usr/share/doc/qt/qtcore/images/statemachine-button-history.png
  • usr/share/doc/qt/qtcore/images/statemachine-button-nested.png
  • usr/share/doc/qt/qtcore/images/statemachine-button.png
  • usr/share/doc/qt/qtcore/images/statemachine-customevents.png
  • usr/share/doc/qt/qtcore/images/statemachine-customevents2.png
  • usr/share/doc/qt/qtcore/images/statemachine-finished.png
  • usr/share/doc/qt/qtcore/images/statemachine-nonparallel.png
  • usr/share/doc/qt/qtcore/images/statemachine-parallel.png
  • usr/share/doc/qt/qtcore/images/stliterators1.png
  • usr/share/doc/qt/qtcore/images/used-in-examples/
  • usr/share/doc/qt/qtcore/images/used-in-examples/ipc/
  • usr/share/doc/qt/qtcore/images/used-in-examples/ipc/sharedmemory/
  • usr/share/doc/qt/qtcore/images/used-in-examples/ipc/sharedmemory/image.png
  • usr/share/doc/qt/qtcore/images/used-in-examples/ipc/sharedmemory/qt.png
  • usr/share/doc/qt/qtcore/implicit-sharing.html
  • usr/share/doc/qt/qtcore/io-functions.html
  • usr/share/doc/qt/qtcore/io.html
  • usr/share/doc/qt/qtcore/json.html
  • usr/share/doc/qt/qtcore/metaobjects.html
  • usr/share/doc/qt/qtcore/object.html
  • usr/share/doc/qt/qtcore/objecttrees.html
  • usr/share/doc/qt/qtcore/plugins.html
  • usr/share/doc/qt/qtcore/properties.html
  • usr/share/doc/qt/qtcore/qabstractanimation-members.html
  • usr/share/doc/qt/qtcore/qabstractanimation-obsolete.html
  • usr/share/doc/qt/qtcore/qabstractanimation.html
  • usr/share/doc/qt/qtcore/qabstracteventdispatcher-members.html
  • usr/share/doc/qt/qtcore/qabstracteventdispatcher-obsolete.html
  • usr/share/doc/qt/qtcore/qabstracteventdispatcher-timerinfo-members.html
  • usr/share/doc/qt/qtcore/qabstracteventdispatcher-timerinfo.html
  • usr/share/doc/qt/qtcore/qabstracteventdispatcher.html
  • usr/share/doc/qt/qtcore/qabstractitemmodel-members.html
  • usr/share/doc/qt/qtcore/qabstractitemmodel-obsolete.html
  • usr/share/doc/qt/qtcore/qabstractitemmodel.html
  • usr/share/doc/qt/qtcore/qabstractlistmodel-members.html
  • usr/share/doc/qt/qtcore/qabstractlistmodel-obsolete.html
  • usr/share/doc/qt/qtcore/qabstractlistmodel.html
  • usr/share/doc/qt/qtcore/qabstractnativeeventfilter-members.html
  • usr/share/doc/qt/qtcore/qabstractnativeeventfilter.html
  • usr/share/doc/qt/qtcore/qabstractproxymodel-members.html
  • usr/share/doc/qt/qtcore/qabstractproxymodel-obsolete.html
  • usr/share/doc/qt/qtcore/qabstractproxymodel.html
  • usr/share/doc/qt/qtcore/qabstractstate-members.html
  • usr/share/doc/qt/qtcore/qabstractstate-obsolete.html
  • usr/share/doc/qt/qtcore/qabstractstate.html
  • usr/share/doc/qt/qtcore/qabstracttablemodel-members.html
  • usr/share/doc/qt/qtcore/qabstracttablemodel-obsolete.html
  • usr/share/doc/qt/qtcore/qabstracttablemodel.html
  • usr/share/doc/qt/qtcore/qabstracttransition-members.html
  • usr/share/doc/qt/qtcore/qabstracttransition-obsolete.html
  • usr/share/doc/qt/qtcore/qabstracttransition.html
  • usr/share/doc/qt/qtcore/qanimationgroup-members.html
  • usr/share/doc/qt/qtcore/qanimationgroup-obsolete.html
  • usr/share/doc/qt/qtcore/qanimationgroup.html
  • usr/share/doc/qt/qtcore/qassociativeiterable-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qassociativeiterable-const-iterator.html
  • usr/share/doc/qt/qtcore/qassociativeiterable-members.html
  • usr/share/doc/qt/qtcore/qassociativeiterable.html
  • usr/share/doc/qt/qtcore/qatomicint-members.html
  • usr/share/doc/qt/qtcore/qatomicint.html
  • usr/share/doc/qt/qtcore/qatomicinteger-members.html
  • usr/share/doc/qt/qtcore/qatomicinteger.html
  • usr/share/doc/qt/qtcore/qatomicpointer-members.html
  • usr/share/doc/qt/qtcore/qatomicpointer.html
  • usr/share/doc/qt/qtcore/qbasictimer-members.html
  • usr/share/doc/qt/qtcore/qbasictimer.html
  • usr/share/doc/qt/qtcore/qbeinteger-members.html
  • usr/share/doc/qt/qtcore/qbeinteger.html
  • usr/share/doc/qt/qtcore/qbitarray-members.html
  • usr/share/doc/qt/qtcore/qbitarray.html
  • usr/share/doc/qt/qtcore/qbuffer-members.html
  • usr/share/doc/qt/qtcore/qbuffer-obsolete.html
  • usr/share/doc/qt/qtcore/qbuffer.html
  • usr/share/doc/qt/qtcore/qbytearray-members.html
  • usr/share/doc/qt/qtcore/qbytearray-obsolete.html
  • usr/share/doc/qt/qtcore/qbytearray.html
  • usr/share/doc/qt/qtcore/qbytearraylist-members.html
  • usr/share/doc/qt/qtcore/qbytearraylist.html
  • usr/share/doc/qt/qtcore/qbytearraymatcher-members.html
  • usr/share/doc/qt/qtcore/qbytearraymatcher.html
  • usr/share/doc/qt/qtcore/qcache-members.html
  • usr/share/doc/qt/qtcore/qcache.html
  • usr/share/doc/qt/qtcore/qcborarray-constiterator-members.html
  • usr/share/doc/qt/qtcore/qcborarray-constiterator.html
  • usr/share/doc/qt/qtcore/qcborarray-iterator-members.html
  • usr/share/doc/qt/qtcore/qcborarray-iterator.html
  • usr/share/doc/qt/qtcore/qcborarray-members.html
  • usr/share/doc/qt/qtcore/qcborarray.html
  • usr/share/doc/qt/qtcore/qcbormap-constiterator-members.html
  • usr/share/doc/qt/qtcore/qcbormap-constiterator.html
  • usr/share/doc/qt/qtcore/qcbormap-iterator-members.html
  • usr/share/doc/qt/qtcore/qcbormap-iterator.html
  • usr/share/doc/qt/qtcore/qcbormap-members.html
  • usr/share/doc/qt/qtcore/qcbormap.html
  • usr/share/doc/qt/qtcore/qcborparsererror-members.html
  • usr/share/doc/qt/qtcore/qcborparsererror.html
  • usr/share/doc/qt/qtcore/qcborstreamreader-members.html
  • usr/share/doc/qt/qtcore/qcborstreamreader-stringresult-members.html
  • usr/share/doc/qt/qtcore/qcborstreamreader-stringresult.html
  • usr/share/doc/qt/qtcore/qcborstreamreader.html
  • usr/share/doc/qt/qtcore/qcborstreamwriter-members.html
  • usr/share/doc/qt/qtcore/qcborstreamwriter.html
  • usr/share/doc/qt/qtcore/qcborvalue-members.html
  • usr/share/doc/qt/qtcore/qcborvalue.html
  • usr/share/doc/qt/qtcore/qchar-members.html
  • usr/share/doc/qt/qtcore/qchar-obsolete.html
  • usr/share/doc/qt/qtcore/qchar.html
  • usr/share/doc/qt/qtcore/qchildevent-members.html
  • usr/share/doc/qt/qtcore/qchildevent.html
  • usr/share/doc/qt/qtcore/qcollator-members.html
  • usr/share/doc/qt/qtcore/qcollator.html
  • usr/share/doc/qt/qtcore/qcollatorsortkey-members.html
  • usr/share/doc/qt/qtcore/qcollatorsortkey.html
  • usr/share/doc/qt/qtcore/qcommandlineoption-members.html
  • usr/share/doc/qt/qtcore/qcommandlineoption-obsolete.html
  • usr/share/doc/qt/qtcore/qcommandlineoption.html
  • usr/share/doc/qt/qtcore/qcommandlineparser-members.html
  • usr/share/doc/qt/qtcore/qcommandlineparser.html
  • usr/share/doc/qt/qtcore/qcontiguouscache-members.html
  • usr/share/doc/qt/qtcore/qcontiguouscache.html
  • usr/share/doc/qt/qtcore/qcoreapplication-members.html
  • usr/share/doc/qt/qtcore/qcoreapplication-obsolete.html
  • usr/share/doc/qt/qtcore/qcoreapplication.html
  • usr/share/doc/qt/qtcore/qcryptographichash-members.html
  • usr/share/doc/qt/qtcore/qcryptographichash.html
  • usr/share/doc/qt/qtcore/qdatastream-members.html
  • usr/share/doc/qt/qtcore/qdatastream-obsolete.html
  • usr/share/doc/qt/qtcore/qdatastream.html
  • usr/share/doc/qt/qtcore/qdate-members.html
  • usr/share/doc/qt/qtcore/qdate-obsolete.html
  • usr/share/doc/qt/qtcore/qdate.html
  • usr/share/doc/qt/qtcore/qdatetime-members.html
  • usr/share/doc/qt/qtcore/qdatetime-obsolete.html
  • usr/share/doc/qt/qtcore/qdatetime.html
  • usr/share/doc/qt/qtcore/qdeadlinetimer-members.html
  • usr/share/doc/qt/qtcore/qdeadlinetimer.html
  • usr/share/doc/qt/qtcore/qdebug-members.html
  • usr/share/doc/qt/qtcore/qdebug.html
  • usr/share/doc/qt/qtcore/qdebugstatesaver-members.html
  • usr/share/doc/qt/qtcore/qdebugstatesaver.html
  • usr/share/doc/qt/qtcore/qdir-members.html
  • usr/share/doc/qt/qtcore/qdir-obsolete.html
  • usr/share/doc/qt/qtcore/qdir.html
  • usr/share/doc/qt/qtcore/qdiriterator-members.html
  • usr/share/doc/qt/qtcore/qdiriterator.html
  • usr/share/doc/qt/qtcore/qdynamicpropertychangeevent-members.html
  • usr/share/doc/qt/qtcore/qdynamicpropertychangeevent.html
  • usr/share/doc/qt/qtcore/qeasingcurve-members.html
  • usr/share/doc/qt/qtcore/qeasingcurve-obsolete.html
  • usr/share/doc/qt/qtcore/qeasingcurve.html
  • usr/share/doc/qt/qtcore/qelapsedtimer-members.html
  • usr/share/doc/qt/qtcore/qelapsedtimer.html
  • usr/share/doc/qt/qtcore/qenablesharedfromthis-members.html
  • usr/share/doc/qt/qtcore/qenablesharedfromthis.html
  • usr/share/doc/qt/qtcore/qevent-members.html
  • usr/share/doc/qt/qtcore/qevent.html
  • usr/share/doc/qt/qtcore/qeventloop-members.html
  • usr/share/doc/qt/qtcore/qeventloop-obsolete.html
  • usr/share/doc/qt/qtcore/qeventloop.html
  • usr/share/doc/qt/qtcore/qeventlooplocker-members.html
  • usr/share/doc/qt/qtcore/qeventlooplocker.html
  • usr/share/doc/qt/qtcore/qeventtransition-members.html
  • usr/share/doc/qt/qtcore/qeventtransition-obsolete.html
  • usr/share/doc/qt/qtcore/qeventtransition.html
  • usr/share/doc/qt/qtcore/qexception-members.html
  • usr/share/doc/qt/qtcore/qexception.html
  • usr/share/doc/qt/qtcore/qexplicitlyshareddatapointer-members.html
  • usr/share/doc/qt/qtcore/qexplicitlyshareddatapointer.html
  • usr/share/doc/qt/qtcore/qfile-members.html
  • usr/share/doc/qt/qtcore/qfile-obsolete.html
  • usr/share/doc/qt/qtcore/qfile.html
  • usr/share/doc/qt/qtcore/qfiledevice-members.html
  • usr/share/doc/qt/qtcore/qfiledevice-obsolete.html
  • usr/share/doc/qt/qtcore/qfiledevice.html
  • usr/share/doc/qt/qtcore/qfileinfo-members.html
  • usr/share/doc/qt/qtcore/qfileinfo-obsolete.html
  • usr/share/doc/qt/qtcore/qfileinfo.html
  • usr/share/doc/qt/qtcore/qfileselector-members.html
  • usr/share/doc/qt/qtcore/qfileselector-obsolete.html
  • usr/share/doc/qt/qtcore/qfileselector.html
  • usr/share/doc/qt/qtcore/qfilesystemwatcher-members.html
  • usr/share/doc/qt/qtcore/qfilesystemwatcher-obsolete.html
  • usr/share/doc/qt/qtcore/qfilesystemwatcher.html
  • usr/share/doc/qt/qtcore/qfinalstate-members.html
  • usr/share/doc/qt/qtcore/qfinalstate-obsolete.html
  • usr/share/doc/qt/qtcore/qfinalstate.html
  • usr/share/doc/qt/qtcore/qflag-members.html
  • usr/share/doc/qt/qtcore/qflag.html
  • usr/share/doc/qt/qtcore/qflags-members.html
  • usr/share/doc/qt/qtcore/qflags.html
  • usr/share/doc/qt/qtcore/qfloat16.html
  • usr/share/doc/qt/qtcore/qfuture-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qfuture-const-iterator.html
  • usr/share/doc/qt/qtcore/qfuture-members.html
  • usr/share/doc/qt/qtcore/qfuture.html
  • usr/share/doc/qt/qtcore/qfutureiterator-members.html
  • usr/share/doc/qt/qtcore/qfutureiterator.html
  • usr/share/doc/qt/qtcore/qfuturesynchronizer-members.html
  • usr/share/doc/qt/qtcore/qfuturesynchronizer.html
  • usr/share/doc/qt/qtcore/qfuturewatcher-members.html
  • usr/share/doc/qt/qtcore/qfuturewatcher-obsolete.html
  • usr/share/doc/qt/qtcore/qfuturewatcher.html
  • usr/share/doc/qt/qtcore/qgenericargument-members.html
  • usr/share/doc/qt/qtcore/qgenericargument.html
  • usr/share/doc/qt/qtcore/qgenericreturnargument-members.html
  • usr/share/doc/qt/qtcore/qgenericreturnargument.html
  • usr/share/doc/qt/qtcore/qglobalstatic-members.html
  • usr/share/doc/qt/qtcore/qglobalstatic-obsolete.html
  • usr/share/doc/qt/qtcore/qglobalstatic.html
  • usr/share/doc/qt/qtcore/qhash-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qhash-const-iterator.html
  • usr/share/doc/qt/qtcore/qhash-iterator-members.html
  • usr/share/doc/qt/qtcore/qhash-iterator.html
  • usr/share/doc/qt/qtcore/qhash-key-iterator-members.html
  • usr/share/doc/qt/qtcore/qhash-key-iterator.html
  • usr/share/doc/qt/qtcore/qhash-members.html
  • usr/share/doc/qt/qtcore/qhash.html
  • usr/share/doc/qt/qtcore/qhashiterator-members.html
  • usr/share/doc/qt/qtcore/qhashiterator.html
  • usr/share/doc/qt/qtcore/qhistorystate-members.html
  • usr/share/doc/qt/qtcore/qhistorystate-obsolete.html
  • usr/share/doc/qt/qtcore/qhistorystate.html
  • usr/share/doc/qt/qtcore/qidentityproxymodel-members.html
  • usr/share/doc/qt/qtcore/qidentityproxymodel-obsolete.html
  • usr/share/doc/qt/qtcore/qidentityproxymodel.html
  • usr/share/doc/qt/qtcore/qiodevice-members.html
  • usr/share/doc/qt/qtcore/qiodevice-obsolete.html
  • usr/share/doc/qt/qtcore/qiodevice.html
  • usr/share/doc/qt/qtcore/qitemselection-members.html
  • usr/share/doc/qt/qtcore/qitemselection.html
  • usr/share/doc/qt/qtcore/qitemselectionmodel-members.html
  • usr/share/doc/qt/qtcore/qitemselectionmodel-obsolete.html
  • usr/share/doc/qt/qtcore/qitemselectionmodel.html
  • usr/share/doc/qt/qtcore/qitemselectionrange-members.html
  • usr/share/doc/qt/qtcore/qitemselectionrange-obsolete.html
  • usr/share/doc/qt/qtcore/qitemselectionrange.html
  • usr/share/doc/qt/qtcore/qjsonarray-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qjsonarray-const-iterator.html
  • usr/share/doc/qt/qtcore/qjsonarray-iterator-members.html
  • usr/share/doc/qt/qtcore/qjsonarray-iterator.html
  • usr/share/doc/qt/qtcore/qjsonarray-members.html
  • usr/share/doc/qt/qtcore/qjsonarray.html
  • usr/share/doc/qt/qtcore/qjsondocument-members.html
  • usr/share/doc/qt/qtcore/qjsondocument.html
  • usr/share/doc/qt/qtcore/qjsonobject-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qjsonobject-const-iterator.html
  • usr/share/doc/qt/qtcore/qjsonobject-iterator-members.html
  • usr/share/doc/qt/qtcore/qjsonobject-iterator.html
  • usr/share/doc/qt/qtcore/qjsonobject-members.html
  • usr/share/doc/qt/qtcore/qjsonobject.html
  • usr/share/doc/qt/qtcore/qjsonparseerror-members.html
  • usr/share/doc/qt/qtcore/qjsonparseerror.html
  • usr/share/doc/qt/qtcore/qjsonvalue-members.html
  • usr/share/doc/qt/qtcore/qjsonvalue.html
  • usr/share/doc/qt/qtcore/qkeyvalueiterator-members.html
  • usr/share/doc/qt/qtcore/qkeyvalueiterator.html
  • usr/share/doc/qt/qtcore/qlatin1char-members.html
  • usr/share/doc/qt/qtcore/qlatin1char.html
  • usr/share/doc/qt/qtcore/qlatin1string-members.html
  • usr/share/doc/qt/qtcore/qlatin1string.html
  • usr/share/doc/qt/qtcore/qleinteger-members.html
  • usr/share/doc/qt/qtcore/qleinteger.html
  • usr/share/doc/qt/qtcore/qlibrary-members.html
  • usr/share/doc/qt/qtcore/qlibrary-obsolete.html
  • usr/share/doc/qt/qtcore/qlibrary.html
  • usr/share/doc/qt/qtcore/qlibraryinfo-members.html
  • usr/share/doc/qt/qtcore/qlibraryinfo-obsolete.html
  • usr/share/doc/qt/qtcore/qlibraryinfo.html
  • usr/share/doc/qt/qtcore/qline-members.html
  • usr/share/doc/qt/qtcore/qline.html
  • usr/share/doc/qt/qtcore/qlinef-members.html
  • usr/share/doc/qt/qtcore/qlinef-obsolete.html
  • usr/share/doc/qt/qtcore/qlinef.html
  • usr/share/doc/qt/qtcore/qlinkedlist-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qlinkedlist-const-iterator.html
  • usr/share/doc/qt/qtcore/qlinkedlist-iterator-members.html
  • usr/share/doc/qt/qtcore/qlinkedlist-iterator.html
  • usr/share/doc/qt/qtcore/qlinkedlist-members.html
  • usr/share/doc/qt/qtcore/qlinkedlist.html
  • usr/share/doc/qt/qtcore/qlinkedlistiterator-members.html
  • usr/share/doc/qt/qtcore/qlinkedlistiterator.html
  • usr/share/doc/qt/qtcore/qlist-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qlist-const-iterator.html
  • usr/share/doc/qt/qtcore/qlist-iterator-members.html
  • usr/share/doc/qt/qtcore/qlist-iterator.html
  • usr/share/doc/qt/qtcore/qlist-members.html
  • usr/share/doc/qt/qtcore/qlist-memorylayout.html
  • usr/share/doc/qt/qtcore/qlist.html
  • usr/share/doc/qt/qtcore/qlistiterator-members.html
  • usr/share/doc/qt/qtcore/qlistiterator.html
  • usr/share/doc/qt/qtcore/qlocale-members.html
  • usr/share/doc/qt/qtcore/qlocale-obsolete.html
  • usr/share/doc/qt/qtcore/qlocale.html
  • usr/share/doc/qt/qtcore/qlockfile-members.html
  • usr/share/doc/qt/qtcore/qlockfile.html
  • usr/share/doc/qt/qtcore/qloggingcategory-members.html
  • usr/share/doc/qt/qtcore/qloggingcategory.html
  • usr/share/doc/qt/qtcore/qmap-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qmap-const-iterator.html
  • usr/share/doc/qt/qtcore/qmap-iterator-members.html
  • usr/share/doc/qt/qtcore/qmap-iterator.html
  • usr/share/doc/qt/qtcore/qmap-key-iterator-members.html
  • usr/share/doc/qt/qtcore/qmap-key-iterator.html
  • usr/share/doc/qt/qtcore/qmap-members.html
  • usr/share/doc/qt/qtcore/qmap.html
  • usr/share/doc/qt/qtcore/qmapiterator-members.html
  • usr/share/doc/qt/qtcore/qmapiterator.html
  • usr/share/doc/qt/qtcore/qmargins-members.html
  • usr/share/doc/qt/qtcore/qmargins.html
  • usr/share/doc/qt/qtcore/qmarginsf-members.html
  • usr/share/doc/qt/qtcore/qmarginsf.html
  • usr/share/doc/qt/qtcore/qmessageauthenticationcode-members.html
  • usr/share/doc/qt/qtcore/qmessageauthenticationcode.html
  • usr/share/doc/qt/qtcore/qmessagelogcontext-members.html
  • usr/share/doc/qt/qtcore/qmessagelogcontext.html
  • usr/share/doc/qt/qtcore/qmessagelogger-members.html
  • usr/share/doc/qt/qtcore/qmessagelogger.html
  • usr/share/doc/qt/qtcore/qmetaclassinfo-members.html
  • usr/share/doc/qt/qtcore/qmetaclassinfo.html
  • usr/share/doc/qt/qtcore/qmetaenum-members.html
  • usr/share/doc/qt/qtcore/qmetaenum.html
  • usr/share/doc/qt/qtcore/qmetamethod-members.html
  • usr/share/doc/qt/qtcore/qmetamethod.html
  • usr/share/doc/qt/qtcore/qmetaobject-connection-members.html
  • usr/share/doc/qt/qtcore/qmetaobject-connection.html
  • usr/share/doc/qt/qtcore/qmetaobject-members.html
  • usr/share/doc/qt/qtcore/qmetaobject.html
  • usr/share/doc/qt/qtcore/qmetaproperty-members.html
  • usr/share/doc/qt/qtcore/qmetaproperty-obsolete.html
  • usr/share/doc/qt/qtcore/qmetaproperty.html
  • usr/share/doc/qt/qtcore/qmetatype-members.html
  • usr/share/doc/qt/qtcore/qmetatype-obsolete.html
  • usr/share/doc/qt/qtcore/qmetatype.html
  • usr/share/doc/qt/qtcore/qmimedata-members.html
  • usr/share/doc/qt/qtcore/qmimedata-obsolete.html
  • usr/share/doc/qt/qtcore/qmimedata.html
  • usr/share/doc/qt/qtcore/qmimedatabase-members.html
  • usr/share/doc/qt/qtcore/qmimedatabase.html
  • usr/share/doc/qt/qtcore/qmimetype-members.html
  • usr/share/doc/qt/qtcore/qmimetype.html
  • usr/share/doc/qt/qtcore/qmodelindex-members.html
  • usr/share/doc/qt/qtcore/qmodelindex-obsolete.html
  • usr/share/doc/qt/qtcore/qmodelindex.html
  • usr/share/doc/qt/qtcore/qmultihash-members.html
  • usr/share/doc/qt/qtcore/qmultihash.html
  • usr/share/doc/qt/qtcore/qmultimap-members.html
  • usr/share/doc/qt/qtcore/qmultimap.html
  • usr/share/doc/qt/qtcore/qmutablehashiterator-members.html
  • usr/share/doc/qt/qtcore/qmutablehashiterator.html
  • usr/share/doc/qt/qtcore/qmutablelinkedlistiterator-members.html
  • usr/share/doc/qt/qtcore/qmutablelinkedlistiterator.html
  • usr/share/doc/qt/qtcore/qmutablelistiterator-members.html
  • usr/share/doc/qt/qtcore/qmutablelistiterator.html
  • usr/share/doc/qt/qtcore/qmutablemapiterator-members.html
  • usr/share/doc/qt/qtcore/qmutablemapiterator.html
  • usr/share/doc/qt/qtcore/qmutablesetiterator-members.html
  • usr/share/doc/qt/qtcore/qmutablesetiterator.html
  • usr/share/doc/qt/qtcore/qmutablevectoriterator-members.html
  • usr/share/doc/qt/qtcore/qmutablevectoriterator.html
  • usr/share/doc/qt/qtcore/qmutex-members.html
  • usr/share/doc/qt/qtcore/qmutex.html
  • usr/share/doc/qt/qtcore/qmutexlocker-members.html
  • usr/share/doc/qt/qtcore/qmutexlocker.html
  • usr/share/doc/qt/qtcore/qobject-members.html
  • usr/share/doc/qt/qtcore/qobject-obsolete.html
  • usr/share/doc/qt/qtcore/qobject.html
  • usr/share/doc/qt/qtcore/qobjectcleanuphandler-members.html
  • usr/share/doc/qt/qtcore/qobjectcleanuphandler-obsolete.html
  • usr/share/doc/qt/qtcore/qobjectcleanuphandler.html
  • usr/share/doc/qt/qtcore/qoperatingsystemversion-members.html
  • usr/share/doc/qt/qtcore/qoperatingsystemversion.html
  • usr/share/doc/qt/qtcore/qpair-members.html
  • usr/share/doc/qt/qtcore/qpair.html
  • usr/share/doc/qt/qtcore/qparallelanimationgroup-members.html
  • usr/share/doc/qt/qtcore/qparallelanimationgroup-obsolete.html
  • usr/share/doc/qt/qtcore/qparallelanimationgroup.html
  • usr/share/doc/qt/qtcore/qpauseanimation-members.html
  • usr/share/doc/qt/qtcore/qpauseanimation-obsolete.html
  • usr/share/doc/qt/qtcore/qpauseanimation.html
  • usr/share/doc/qt/qtcore/qpersistentmodelindex-members.html
  • usr/share/doc/qt/qtcore/qpersistentmodelindex-obsolete.html
  • usr/share/doc/qt/qtcore/qpersistentmodelindex.html
  • usr/share/doc/qt/qtcore/qpluginloader-members.html
  • usr/share/doc/qt/qtcore/qpluginloader-obsolete.html
  • usr/share/doc/qt/qtcore/qpluginloader.html
  • usr/share/doc/qt/qtcore/qpoint-members.html
  • usr/share/doc/qt/qtcore/qpoint.html
  • usr/share/doc/qt/qtcore/qpointer-members.html
  • usr/share/doc/qt/qtcore/qpointer.html
  • usr/share/doc/qt/qtcore/qpointf-members.html
  • usr/share/doc/qt/qtcore/qpointf.html
  • usr/share/doc/qt/qtcore/qprocess-createprocessarguments-members.html
  • usr/share/doc/qt/qtcore/qprocess-createprocessarguments.html
  • usr/share/doc/qt/qtcore/qprocess-members.html
  • usr/share/doc/qt/qtcore/qprocess-obsolete.html
  • usr/share/doc/qt/qtcore/qprocess.html
  • usr/share/doc/qt/qtcore/qprocessenvironment-members.html
  • usr/share/doc/qt/qtcore/qprocessenvironment.html
  • usr/share/doc/qt/qtcore/qpropertyanimation-members.html
  • usr/share/doc/qt/qtcore/qpropertyanimation-obsolete.html
  • usr/share/doc/qt/qtcore/qpropertyanimation.html
  • usr/share/doc/qt/qtcore/qqueue-members.html
  • usr/share/doc/qt/qtcore/qqueue.html
  • usr/share/doc/qt/qtcore/qrandomgenerator-members.html
  • usr/share/doc/qt/qtcore/qrandomgenerator.html
  • usr/share/doc/qt/qtcore/qrandomgenerator64-members.html
  • usr/share/doc/qt/qtcore/qrandomgenerator64.html
  • usr/share/doc/qt/qtcore/qreadlocker-members.html
  • usr/share/doc/qt/qtcore/qreadlocker.html
  • usr/share/doc/qt/qtcore/qreadwritelock-members.html
  • usr/share/doc/qt/qtcore/qreadwritelock.html
  • usr/share/doc/qt/qtcore/qrect-members.html
  • usr/share/doc/qt/qtcore/qrect.html
  • usr/share/doc/qt/qtcore/qrectf-members.html
  • usr/share/doc/qt/qtcore/qrectf.html
  • usr/share/doc/qt/qtcore/qregexp-members.html
  • usr/share/doc/qt/qtcore/qregexp.html
  • usr/share/doc/qt/qtcore/qregularexpression-members.html
  • usr/share/doc/qt/qtcore/qregularexpression.html
  • usr/share/doc/qt/qtcore/qregularexpressionmatch-members.html
  • usr/share/doc/qt/qtcore/qregularexpressionmatch.html
  • usr/share/doc/qt/qtcore/qregularexpressionmatchiterator-members.html
  • usr/share/doc/qt/qtcore/qregularexpressionmatchiterator.html
  • usr/share/doc/qt/qtcore/qresource-members.html
  • usr/share/doc/qt/qtcore/qresource-obsolete.html
  • usr/share/doc/qt/qtcore/qresource.html
  • usr/share/doc/qt/qtcore/qrunnable-members.html
  • usr/share/doc/qt/qtcore/qrunnable.html
  • usr/share/doc/qt/qtcore/qsavefile-members.html
  • usr/share/doc/qt/qtcore/qsavefile-obsolete.html
  • usr/share/doc/qt/qtcore/qsavefile.html
  • usr/share/doc/qt/qtcore/qscopedarraypointer-members.html
  • usr/share/doc/qt/qtcore/qscopedarraypointer.html
  • usr/share/doc/qt/qtcore/qscopedpointer-members.html
  • usr/share/doc/qt/qtcore/qscopedpointer.html
  • usr/share/doc/qt/qtcore/qscopedvaluerollback-members.html
  • usr/share/doc/qt/qtcore/qscopedvaluerollback.html
  • usr/share/doc/qt/qtcore/qsemaphore-members.html
  • usr/share/doc/qt/qtcore/qsemaphore.html
  • usr/share/doc/qt/qtcore/qsemaphorereleaser-members.html
  • usr/share/doc/qt/qtcore/qsemaphorereleaser.html
  • usr/share/doc/qt/qtcore/qsequentialanimationgroup-members.html
  • usr/share/doc/qt/qtcore/qsequentialanimationgroup-obsolete.html
  • usr/share/doc/qt/qtcore/qsequentialanimationgroup.html
  • usr/share/doc/qt/qtcore/qsequentialiterable-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qsequentialiterable-const-iterator.html
  • usr/share/doc/qt/qtcore/qsequentialiterable-members.html
  • usr/share/doc/qt/qtcore/qsequentialiterable.html
  • usr/share/doc/qt/qtcore/qset-const-iterator-members.html
  • usr/share/doc/qt/qtcore/qset-const-iterator.html
  • usr/share/doc/qt/qtcore/qset-iterator-members.html
  • usr/share/doc/qt/qtcore/qset-iterator.html
  • usr/share/doc/qt/qtcore/qset-members.html
  • usr/share/doc/qt/qtcore/qset.html
  • usr/share/doc/qt/qtcore/qsetiterator-members.html
  • usr/share/doc/qt/qtcore/qsetiterator.html
  • usr/share/doc/qt/qtcore/qsettings-members.html
  • usr/share/doc/qt/qtcore/qsettings-obsolete.html
  • usr/share/doc/qt/qtcore/qsettings.html
  • usr/share/doc/qt/qtcore/qshareddata-members.html
  • usr/share/doc/qt/qtcore/qshareddata.html
  • usr/share/doc/qt/qtcore/qshareddatapointer-members.html
  • usr/share/doc/qt/qtcore/qshareddatapointer.html
  • usr/share/doc/qt/qtcore/qsharedmemory-members.html
  • usr/share/doc/qt/qtcore/qsharedmemory-obsolete.html
  • usr/share/doc/qt/qtcore/qsharedmemory.html
  • usr/share/doc/qt/qtcore/qsharedpointer-members.html
  • usr/share/doc/qt/qtcore/qsharedpointer.html
  • usr/share/doc/qt/qtcore/qsignalblocker-members.html
  • usr/share/doc/qt/qtcore/qsignalblocker.html
  • usr/share/doc/qt/qtcore/qsignalmapper-members.html
  • usr/share/doc/qt/qtcore/qsignalmapper-obsolete.html
  • usr/share/doc/qt/qtcore/qsignalmapper.html
  • usr/share/doc/qt/qtcore/qsignaltransition-members.html
  • usr/share/doc/qt/qtcore/qsignaltransition-obsolete.html
  • usr/share/doc/qt/qtcore/qsignaltransition.html
  • usr/share/doc/qt/qtcore/qsize-members.html
  • usr/share/doc/qt/qtcore/qsize.html
  • usr/share/doc/qt/qtcore/qsizef-members.html
  • usr/share/doc/qt/qtcore/qsizef.html
  • usr/share/doc/qt/qtcore/qsocketnotifier-members.html
  • usr/share/doc/qt/qtcore/qsocketnotifier-obsolete.html
  • usr/share/doc/qt/qtcore/qsocketnotifier.html
  • usr/share/doc/qt/qtcore/qsortfilterproxymodel-members.html
  • usr/share/doc/qt/qtcore/qsortfilterproxymodel-obsolete.html
  • usr/share/doc/qt/qtcore/qsortfilterproxymodel.html
  • usr/share/doc/qt/qtcore/qstack-members.html
  • usr/share/doc/qt/qtcore/qstack.html
  • usr/share/doc/qt/qtcore/qstandardpaths-members.html
  • usr/share/doc/qt/qtcore/qstandardpaths.html
  • usr/share/doc/qt/qtcore/qstate-members.html
  • usr/share/doc/qt/qtcore/qstate-obsolete.html
  • usr/share/doc/qt/qtcore/qstate.html
  • usr/share/doc/qt/qtcore/qstatemachine-members.html
  • usr/share/doc/qt/qtcore/qstatemachine-obsolete.html
  • usr/share/doc/qt/qtcore/qstatemachine-signalevent-members.html
  • usr/share/doc/qt/qtcore/qstatemachine-signalevent.html
  • usr/share/doc/qt/qtcore/qstatemachine-wrappedevent-members.html
  • usr/share/doc/qt/qtcore/qstatemachine-wrappedevent.html
  • usr/share/doc/qt/qtcore/qstatemachine.html
  • usr/share/doc/qt/qtcore/qstaticbytearraymatcher-members.html
  • usr/share/doc/qt/qtcore/qstaticbytearraymatcher.html
  • usr/share/doc/qt/qtcore/qstaticplugin-members.html
  • usr/share/doc/qt/qtcore/qstaticplugin.html
  • usr/share/doc/qt/qtcore/qstorageinfo-members.html
  • usr/share/doc/qt/qtcore/qstorageinfo.html
  • usr/share/doc/qt/qtcore/qstring-members.html
  • usr/share/doc/qt/qtcore/qstring-null.html
  • usr/share/doc/qt/qtcore/qstring-obsolete.html
  • usr/share/doc/qt/qtcore/qstring.html
  • usr/share/doc/qt/qtcore/qstringlist-members.html
  • usr/share/doc/qt/qtcore/qstringlist.html
  • usr/share/doc/qt/qtcore/qstringlistmodel-members.html
  • usr/share/doc/qt/qtcore/qstringlistmodel-obsolete.html
  • usr/share/doc/qt/qtcore/qstringlistmodel.html
  • usr/share/doc/qt/qtcore/qstringmatcher-members.html
  • usr/share/doc/qt/qtcore/qstringmatcher.html
  • usr/share/doc/qt/qtcore/qstringref-members.html
  • usr/share/doc/qt/qtcore/qstringref-obsolete.html
  • usr/share/doc/qt/qtcore/qstringref.html
  • usr/share/doc/qt/qtcore/qstringview-members.html
  • usr/share/doc/qt/qtcore/qstringview.html
  • usr/share/doc/qt/qtcore/qsysinfo-members.html
  • usr/share/doc/qt/qtcore/qsysinfo-obsolete.html
  • usr/share/doc/qt/qtcore/qsysinfo.html
  • usr/share/doc/qt/qtcore/qsystemsemaphore-members.html
  • usr/share/doc/qt/qtcore/qsystemsemaphore.html
  • usr/share/doc/qt/qtcore/qt-obsolete.html
  • usr/share/doc/qt/qtcore/qt.html
  • usr/share/doc/qt/qtcore/qtalgorithms-obsolete.html
  • usr/share/doc/qt/qtcore/qtalgorithms.html
  • usr/share/doc/qt/qtcore/qtcborcommon-members.html
  • usr/share/doc/qt/qtcore/qtcborcommon.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-android-gradle-wrapper.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-doubleconversion.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-easing.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-forkfd.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-freebsd.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-md4.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-md5.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-pcre2-sljit.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-pcre2.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-psl.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-qbig5codecs.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-qbkcodec.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-qeucjpcodec.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-qeuckrcodec.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-qeventdispatcher-cf.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-qjiscodec.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-qsjiscodec.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-qtsciicodec.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-rfc6234.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-sha1.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-sha3-endian.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-sha3-keccak.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-tinycbor.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-unicode-character-database.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-unicode-cldr.html
  • usr/share/doc/qt/qtcore/qtcore-attribution-zlib.html
  • usr/share/doc/qt/qtcore/qtcore-index.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneclient-client-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneclient-client-h.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneclient-example.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneclient-localfortuneclient-pro.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneclient-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneserver-example.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneserver-localfortuneserver-pro.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneserver-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneserver-server-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneserver-server-h.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-sharedmemory-dialog-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-sharedmemory-dialog-h.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-sharedmemory-dialog-ui.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-sharedmemory-example.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-sharedmemory-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-ipc-sharedmemory-sharedmemory-pro.html
  • usr/share/doc/qt/qtcore/qtcore-mimetypes-mimetypebrowser-example.html
  • usr/share/doc/qt/qtcore/qtcore-mimetypes-mimetypebrowser-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-h.html
  • usr/share/doc/qt/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypebrowser-pro.html
  • usr/share/doc/qt/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-h.html
  • usr/share/doc/qt/qtcore/qtcore-module.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-character-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-character-h.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-example.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-game-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-game-h.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-level-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-level-h.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-serialization-savegame-savegame-pro.html
  • usr/share/doc/qt/qtcore/qtcore-threads-mandelbrot-example.html
  • usr/share/doc/qt/qtcore/qtcore-threads-mandelbrot-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-mandelbrot-mandelbrot-pro.html
  • usr/share/doc/qt/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-h.html
  • usr/share/doc/qt/qtcore/qtcore-threads-mandelbrot-renderthread-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-mandelbrot-renderthread-h.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-block-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-block-h.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-example.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-queuedcustomtype-pro.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-renderthread-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-renderthread-h.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-window-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-window-h.html
  • usr/share/doc/qt/qtcore/qtcore-threads-semaphores-example.html
  • usr/share/doc/qt/qtcore/qtcore-threads-semaphores-semaphores-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-semaphores-semaphores-pro.html
  • usr/share/doc/qt/qtcore/qtcore-threads-waitconditions-example.html
  • usr/share/doc/qt/qtcore/qtcore-threads-waitconditions-waitconditions-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-threads-waitconditions-waitconditions-pro.html
  • usr/share/doc/qt/qtcore/qtcore-tools-contiguouscache-contiguouscache-pro.html
  • usr/share/doc/qt/qtcore/qtcore-tools-contiguouscache-example.html
  • usr/share/doc/qt/qtcore/qtcore-tools-contiguouscache-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-tools-contiguouscache-randomlistmodel-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-tools-contiguouscache-randomlistmodel-h.html
  • usr/share/doc/qt/qtcore/qtcore-tools-customtype-customtype-pro.html
  • usr/share/doc/qt/qtcore/qtcore-tools-customtype-example.html
  • usr/share/doc/qt/qtcore/qtcore-tools-customtype-main-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-tools-customtype-message-cpp.html
  • usr/share/doc/qt/qtcore/qtcore-tools-customtype-message-h.html
  • usr/share/doc/qt/qtcore/qtcore.index
  • usr/share/doc/qt/qtcore/qtcore.qhp
  • usr/share/doc/qt/qtcore/qtcore.qhp.sha1
  • usr/share/doc/qt/qtcore/qtcore.tags
  • usr/share/doc/qt/qtcore/qtemporarydir-members.html
  • usr/share/doc/qt/qtcore/qtemporarydir.html
  • usr/share/doc/qt/qtcore/qtemporaryfile-members.html
  • usr/share/doc/qt/qtcore/qtemporaryfile-obsolete.html
  • usr/share/doc/qt/qtcore/qtemporaryfile.html
  • usr/share/doc/qt/qtcore/qtendian.html
  • usr/share/doc/qt/qtcore/qtextboundaryfinder-members.html
  • usr/share/doc/qt/qtcore/qtextboundaryfinder.html
  • usr/share/doc/qt/qtcore/qtextcodec-converterstate-members.html
  • usr/share/doc/qt/qtcore/qtextcodec-converterstate.html
  • usr/share/doc/qt/qtcore/qtextcodec-members.html
  • usr/share/doc/qt/qtcore/qtextcodec.html
  • usr/share/doc/qt/qtcore/qtextdecoder-members.html
  • usr/share/doc/qt/qtcore/qtextdecoder.html
  • usr/share/doc/qt/qtcore/qtextencoder-members.html
  • usr/share/doc/qt/qtcore/qtextencoder.html
  • usr/share/doc/qt/qtcore/qtextstream-members.html
  • usr/share/doc/qt/qtcore/qtextstream.html
  • usr/share/doc/qt/qtcore/qtglobal-obsolete.html
  • usr/share/doc/qt/qtcore/qtglobal.html
  • usr/share/doc/qt/qtcore/qthread-members.html
  • usr/share/doc/qt/qtcore/qthread-obsolete.html
  • usr/share/doc/qt/qtcore/qthread.html
  • usr/share/doc/qt/qtcore/qthreadpool-members.html
  • usr/share/doc/qt/qtcore/qthreadpool-obsolete.html
  • usr/share/doc/qt/qtcore/qthreadpool.html
  • usr/share/doc/qt/qtcore/qthreadstorage-members.html
  • usr/share/doc/qt/qtcore/qthreadstorage.html
  • usr/share/doc/qt/qtcore/qtime-members.html
  • usr/share/doc/qt/qtcore/qtime.html
  • usr/share/doc/qt/qtcore/qtimeline-members.html
  • usr/share/doc/qt/qtcore/qtimeline-obsolete.html
  • usr/share/doc/qt/qtcore/qtimeline.html
  • usr/share/doc/qt/qtcore/qtimer-members.html
  • usr/share/doc/qt/qtcore/qtimer-obsolete.html
  • usr/share/doc/qt/qtcore/qtimer.html
  • usr/share/doc/qt/qtcore/qtimerevent-members.html
  • usr/share/doc/qt/qtcore/qtimerevent.html
  • usr/share/doc/qt/qtcore/qtimezone-members.html
  • usr/share/doc/qt/qtcore/qtimezone-offsetdata-members.html
  • usr/share/doc/qt/qtcore/qtimezone-offsetdata.html
  • usr/share/doc/qt/qtcore/qtimezone.html
  • usr/share/doc/qt/qtcore/qtmath.html
  • usr/share/doc/qt/qtcore/qtplugin.html
  • usr/share/doc/qt/qtcore/qtranslator-members.html
  • usr/share/doc/qt/qtcore/qtranslator-obsolete.html
  • usr/share/doc/qt/qtcore/qtranslator.html
  • usr/share/doc/qt/qtcore/qunhandledexception-members.html
  • usr/share/doc/qt/qtcore/qunhandledexception.html
  • usr/share/doc/qt/qtcore/qurl-members.html
  • usr/share/doc/qt/qtcore/qurl-obsolete.html
  • usr/share/doc/qt/qtcore/qurl.html
  • usr/share/doc/qt/qtcore/qurlquery-members.html
  • usr/share/doc/qt/qtcore/qurlquery.html
  • usr/share/doc/qt/qtcore/quuid-members.html
  • usr/share/doc/qt/qtcore/quuid.html
  • usr/share/doc/qt/qtcore/qvariant-handler-members.html
  • usr/share/doc/qt/qtcore/qvariant-handler.html
  • usr/share/doc/qt/qtcore/qvariant-members.html
  • usr/share/doc/qt/qtcore/qvariant-obsolete.html
  • usr/share/doc/qt/qtcore/qvariant-private-data-members.html
  • usr/share/doc/qt/qtcore/qvariant-private-data.html
  • usr/share/doc/qt/qtcore/qvariant-private-members.html
  • usr/share/doc/qt/qtcore/qvariant-private.html
  • usr/share/doc/qt/qtcore/qvariant-privateshared-members.html
  • usr/share/doc/qt/qtcore/qvariant-privateshared.html
  • usr/share/doc/qt/qtcore/qvariant.html
  • usr/share/doc/qt/qtcore/qvariantanimation-members.html
  • usr/share/doc/qt/qtcore/qvariantanimation-obsolete.html
  • usr/share/doc/qt/qtcore/qvariantanimation.html
  • usr/share/doc/qt/qtcore/qvarlengtharray-members.html
  • usr/share/doc/qt/qtcore/qvarlengtharray.html
  • usr/share/doc/qt/qtcore/qvector-members.html
  • usr/share/doc/qt/qtcore/qvector.html
  • usr/share/doc/qt/qtcore/qvectoriterator-members.html
  • usr/share/doc/qt/qtcore/qvectoriterator.html
  • usr/share/doc/qt/qtcore/qversionnumber-members.html
  • usr/share/doc/qt/qtcore/qversionnumber.html
  • usr/share/doc/qt/qtcore/qwaitcondition-members.html
  • usr/share/doc/qt/qtcore/qwaitcondition.html
  • usr/share/doc/qt/qtcore/qweakpointer-members.html
  • usr/share/doc/qt/qtcore/qweakpointer-obsolete.html
  • usr/share/doc/qt/qtcore/qweakpointer.html
  • usr/share/doc/qt/qtcore/qwineventnotifier-members.html
  • usr/share/doc/qt/qtcore/qwineventnotifier-obsolete.html
  • usr/share/doc/qt/qtcore/qwineventnotifier.html
  • usr/share/doc/qt/qtcore/qwritelocker-members.html
  • usr/share/doc/qt/qtcore/qwritelocker.html
  • usr/share/doc/qt/qtcore/qxmlstreamattribute-members.html
  • usr/share/doc/qt/qtcore/qxmlstreamattribute.html
  • usr/share/doc/qt/qtcore/qxmlstreamattributes-members.html
  • usr/share/doc/qt/qtcore/qxmlstreamattributes.html
  • usr/share/doc/qt/qtcore/qxmlstreamentitydeclaration-members.html
  • usr/share/doc/qt/qtcore/qxmlstreamentitydeclaration.html
  • usr/share/doc/qt/qtcore/qxmlstreamentityresolver-members.html
  • usr/share/doc/qt/qtcore/qxmlstreamentityresolver.html
  • usr/share/doc/qt/qtcore/qxmlstreamnamespacedeclaration-members.html
  • usr/share/doc/qt/qtcore/qxmlstreamnamespacedeclaration.html
  • usr/share/doc/qt/qtcore/qxmlstreamnotationdeclaration-members.html
  • usr/share/doc/qt/qtcore/qxmlstreamnotationdeclaration.html
  • usr/share/doc/qt/qtcore/qxmlstreamreader-members.html
  • usr/share/doc/qt/qtcore/qxmlstreamreader.html
  • usr/share/doc/qt/qtcore/qxmlstreamwriter-members.html
  • usr/share/doc/qt/qtcore/qxmlstreamwriter.html
  • usr/share/doc/qt/qtcore/resources.html
  • usr/share/doc/qt/qtcore/shared.html
  • usr/share/doc/qt/qtcore/signalsandslots.html
  • usr/share/doc/qt/qtcore/statemachine-api.html
  • usr/share/doc/qt/qtcore/statemachine.html
  • usr/share/doc/qt/qtcore/style/
  • usr/share/doc/qt/qtcore/style/offline-simple.css
  • usr/share/doc/qt/qtcore/style/offline.css
  • usr/share/doc/qt/qtcore/timers.html
  • usr/share/doc/qt/qtdatavis3d.qch
  • usr/share/doc/qt/qtdatavisualization/
  • usr/share/doc/qt/qtdatavisualization/datavisualization-examples.html
  • usr/share/doc/qt/qtdatavisualization/examples-manifest.xml
  • usr/share/doc/qt/qtdatavisualization/images/
  • usr/share/doc/qt/qtdatavisualization/images/arrow_bc.png
  • usr/share/doc/qt/qtdatavisualization/images/audiolevels-example.png
  • usr/share/doc/qt/qtdatavisualization/images/bars-example.png
  • usr/share/doc/qt/qtdatavisualization/images/bgrContent.png
  • usr/share/doc/qt/qtdatavisualization/images/btn_next.png
  • usr/share/doc/qt/qtdatavisualization/images/btn_prev.png
  • usr/share/doc/qt/qtdatavisualization/images/bullet_dn.png
  • usr/share/doc/qt/qtdatavisualization/images/bullet_sq.png
  • usr/share/doc/qt/qtdatavisualization/images/custominput-example.png
  • usr/share/doc/qt/qtdatavisualization/images/customitems-example.png
  • usr/share/doc/qt/qtdatavisualization/images/customproxy-example.png
  • usr/share/doc/qt/qtdatavisualization/images/draggableaxes-example.png
  • usr/share/doc/qt/qtdatavisualization/images/home.png
  • usr/share/doc/qt/qtdatavisualization/images/ico_note.png
  • usr/share/doc/qt/qtdatavisualization/images/ico_note_attention.png
  • usr/share/doc/qt/qtdatavisualization/images/ico_out.png
  • usr/share/doc/qt/qtdatavisualization/images/itemmodel-example-2.png
  • usr/share/doc/qt/qtdatavisualization/images/itemmodel-example.png
  • usr/share/doc/qt/qtdatavisualization/images/logo.png
  • usr/share/doc/qt/qtdatavisualization/images/q3dbars-minimal.png
  • usr/share/doc/qt/qtdatavisualization/images/q3dscatter-minimal.png
  • usr/share/doc/qt/qtdatavisualization/images/q3dsurface-minimal.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlaxisdrag-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlaxisformatter-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlbars-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlcustominput-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmllegend-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlmultigraph-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmloscilloscope-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlscatter-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlspectrogram-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlsurface-example.png
  • usr/share/doc/qt/qtdatavisualization/images/qmlsurfacelayers-example.png
  • usr/share/doc/qt/qtdatavisualization/images/rotations-example.png
  • usr/share/doc/qt/qtdatavisualization/images/scatter-example.png
  • usr/share/doc/qt/qtdatavisualization/images/surface-example.png
  • usr/share/doc/qt/qtdatavisualization/images/texturesurface-example.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/customitems/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/customitems/layer_1.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/customitems/layer_2.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/customitems/layer_3.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlaxisdrag/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlaxisdrag/qml/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlaxisdrag/qml/qmlaxisdrag/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlaxisdrag/qml/qmlaxisdrag/cubetexture.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlsurface/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlsurface/heightmap.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlsurfacelayers/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlsurfacelayers/layer_1.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlsurfacelayers/layer_2.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/qmlsurfacelayers/layer_3.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/surface/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/surface/mountain.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/texturesurface/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/texturesurface/maptexture.jpg
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/texturesurface/topography.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/volumetric/
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/volumetric/layer_ground.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/volumetric/layer_magma.png
  • usr/share/doc/qt/qtdatavisualization/images/used-in-examples/volumetric/layer_water.png
  • usr/share/doc/qt/qtdatavisualization/images/volumetric-example.png
  • usr/share/doc/qt/qtdatavisualization/q3dbars-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dbars-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dbars.html
  • usr/share/doc/qt/qtdatavisualization/q3dcamera-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dcamera-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dcamera.html
  • usr/share/doc/qt/qtdatavisualization/q3dinputhandler-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dinputhandler-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dinputhandler.html
  • usr/share/doc/qt/qtdatavisualization/q3dlight-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dlight-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dlight.html
  • usr/share/doc/qt/qtdatavisualization/q3dobject-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dobject-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dobject.html
  • usr/share/doc/qt/qtdatavisualization/q3dscatter-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dscatter-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dscatter.html
  • usr/share/doc/qt/qtdatavisualization/q3dscene-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dscene-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dscene.html
  • usr/share/doc/qt/qtdatavisualization/q3dsurface-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dsurface-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dsurface.html
  • usr/share/doc/qt/qtdatavisualization/q3dtheme-members.html
  • usr/share/doc/qt/qtdatavisualization/q3dtheme-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/q3dtheme.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3daxis-members.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3daxis-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3daxis.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dgraph-members.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dgraph-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dgraph.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dinputhandler-members.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dinputhandler-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dinputhandler.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dseries-members.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dseries-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qabstract3dseries.html
  • usr/share/doc/qt/qtdatavisualization/qabstractdataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qabstractdataproxy-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qabstractdataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qbar3dseries-members.html
  • usr/share/doc/qt/qtdatavisualization/qbar3dseries-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qbar3dseries.html
  • usr/share/doc/qt/qtdatavisualization/qbardataitem-members.html
  • usr/share/doc/qt/qtdatavisualization/qbardataitem.html
  • usr/share/doc/qt/qtdatavisualization/qbardataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qbardataproxy-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qbardataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qcategory3daxis-members.html
  • usr/share/doc/qt/qtdatavisualization/qcategory3daxis-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qcategory3daxis.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3ditem-members.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3ditem-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3ditem.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3dlabel-members.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3dlabel-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3dlabel.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3dvolume-members.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3dvolume-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qcustom3dvolume.html
  • usr/share/doc/qt/qtdatavisualization/qheightmapsurfacedataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qheightmapsurfacedataproxy-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qheightmapsurfacedataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelbardataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelbardataproxy-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelbardataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelscatterdataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelscatterdataproxy-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelscatterdataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelsurfacedataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelsurfacedataproxy-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qitemmodelsurfacedataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qlogvalue3daxisformatter-members.html
  • usr/share/doc/qt/qtdatavisualization/qlogvalue3daxisformatter-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qlogvalue3daxisformatter.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstract3dseries-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstract3dseries.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractaxis3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractaxis3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractdataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractdataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractgraph3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractgraph3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractinputhandler3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractinputhandler3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bar3dseries-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bar3dseries.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bardataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bardataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bars3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bars3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-camera3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-camera3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-categoryaxis3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-categoryaxis3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-colorgradient-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-colorgradient.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-colorgradientstop-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-colorgradientstop.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3ditem-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3ditem.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3dlabel-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3dlabel.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3dvolume-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3dvolume.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-heightmapsurfacedataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-heightmapsurfacedataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-inputhandler3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-inputhandler3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelbardataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelbardataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelscatterdataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelscatterdataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelsurfacedataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelsurfacedataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-light3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-light3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-logvalueaxis3dformatter-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-logvalueaxis3dformatter.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-object3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-object3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatter3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatter3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatter3dseries-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatter3dseries.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatterdataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatterdataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scene3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scene3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surface3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surface3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surface3dseries-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surface3dseries.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surfacedataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surfacedataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-theme3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-theme3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-themecolor-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-themecolor.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-touchinputhandler3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-touchinputhandler3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-valueaxis3d-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-valueaxis3d.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-valueaxis3dformatter-members.html
  • usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-valueaxis3dformatter.html
  • usr/share/doc/qt/qtdatavisualization/qscatter3dseries-members.html
  • usr/share/doc/qt/qtdatavisualization/qscatter3dseries-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qscatter3dseries.html
  • usr/share/doc/qt/qtdatavisualization/qscatterdataitem-members.html
  • usr/share/doc/qt/qtdatavisualization/qscatterdataitem.html
  • usr/share/doc/qt/qtdatavisualization/qscatterdataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qscatterdataproxy-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qscatterdataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qsurface3dseries-members.html
  • usr/share/doc/qt/qtdatavisualization/qsurface3dseries-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qsurface3dseries.html
  • usr/share/doc/qt/qtdatavisualization/qsurfacedataitem-members.html
  • usr/share/doc/qt/qtdatavisualization/qsurfacedataitem.html
  • usr/share/doc/qt/qtdatavisualization/qsurfacedataproxy-members.html
  • usr/share/doc/qt/qtdatavisualization/qsurfacedataproxy-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qsurfacedataproxy.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavis3d.qhp
  • usr/share/doc/qt/qtdatavisualization/qtdatavis3d.qhp.sha1
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-audiolevels-audiolevels-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-audiolevels-audiolevels-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-audiolevels-audiolevels-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-audiolevels-audiolevelsiodevice-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-audiolevels-audiolevelsiodevice-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-audiolevels-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-audiolevels-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-bars-bars-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-bars-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-bars-graphmodifier-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-bars-graphmodifier-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-bars-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-custominput-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-custominput-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-custominputhandler-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-custominputhandler-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-scatterdatamodifier-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-scatterdatamodifier-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customitems-customitemgraph-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customitems-customitemgraph-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customitems-customitems-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customitems-customitems-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customitems-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customitems-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-customproxy-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-customproxy-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-rainfallgraph-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-rainfallgraph-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-variantbardatamapping-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-variantbardatamapping-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-variantbardataproxy-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-variantbardataproxy-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-variantdataset-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-variantdataset-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-data-handling.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-draggableaxes-axesinputhandler-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-draggableaxes-axesinputhandler-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-draggableaxes-data-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-draggableaxes-data-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-draggableaxes-draggableaxes-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-draggableaxes-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-draggableaxes-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-index.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-interacting-with-data.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-itemmodel-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-itemmodel-itemmodel-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-itemmodel-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-known-issues.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-module.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-overview.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisdrag-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisdrag-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisdrag-qml-qmlaxisdrag-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisdrag-qml-qmlaxisdrag-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisdrag-qmlaxisdrag-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisdrag-qmlaxisdrag-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-customformatter-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-customformatter-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-data-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qmlaxisformatter-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qmlaxisformatter-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlbars-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlbars-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlbars-qml-qmlbars-axes-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlbars-qml-qmlbars-data-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlbars-qml-qmlbars-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlbars-qmlbars-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlbars-qmlbars-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlcustominput-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlcustominput-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlcustominput-qml-qmlcustominput-data-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlcustominput-qml-qmlcustominput-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlcustominput-qml-qmlcustominput-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlcustominput-qmlcustominput-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlcustominput-qmlcustominput-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-qml-qmllegend-data-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-qml-qmllegend-legenditem-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-qml-qmllegend-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-qml-qmllegend-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-qmllegend-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-qmllegend-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmodule.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmultigraph-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmultigraph-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-data-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmultigraph-qmlmultigraph-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmultigraph-qmlmultigraph-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-datasource-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-datasource-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-qml-qmloscilloscope-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-qml-qmloscilloscope-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-qmloscilloscope-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-qmloscilloscope-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlscatter-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlscatter-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlscatter-qml-qmlscatter-data-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlscatter-qml-qmlscatter-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlscatter-qml-qmlscatter-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlscatter-qmlscatter-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlscatter-qmlscatter-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlspectrogram-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlspectrogram-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-data-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlspectrogram-qmlspectrogram-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlspectrogram-qmlspectrogram-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurface-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurface-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurface-qml-qmlsurface-data-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurface-qml-qmlsurface-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurface-qml-qmlsurface-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurface-qmlsurface-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurface-qmlsurface-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-qml-qmlsurfacelayers-main-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-qml-qmlsurfacelayers-newbutton-qml.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-qmlsurfacelayers-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-qmlsurfacelayers-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-rotations-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-rotations-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-rotations-rotations-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-rotations-rotations-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-rotations-scatterdatamodifier-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-rotations-scatterdatamodifier-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-scatter-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-scatter-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-scatter-scatter-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-scatter-scatterdatamodifier-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-scatter-scatterdatamodifier-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-surface-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-surface-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-surface-surface-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-surface-surface-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-surface-surfacegraph-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-surface-surfacegraph-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-custominputhandler-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-custominputhandler-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-highlightseries-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-highlightseries-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-surfacegraph-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-surfacegraph-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-texturedsurface-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-texturesurface-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-topographicseries-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-topographicseries-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-volumetric-example.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-volumetric-main-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-volumetric-volumetric-cpp.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-volumetric-volumetric-h.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-volumetric-volumetric-pro.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization-volumetric-volumetric-qrc.html
  • usr/share/doc/qt/qtdatavisualization/qtdatavisualization.index
  • usr/share/doc/qt/qtdatavisualization/qtouch3dinputhandler-members.html
  • usr/share/doc/qt/qtdatavisualization/qtouch3dinputhandler-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qtouch3dinputhandler.html
  • usr/share/doc/qt/qtdatavisualization/qvalue3daxis-members.html
  • usr/share/doc/qt/qtdatavisualization/qvalue3daxis-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qvalue3daxis.html
  • usr/share/doc/qt/qtdatavisualization/qvalue3daxisformatter-members.html
  • usr/share/doc/qt/qtdatavisualization/qvalue3daxisformatter-obsolete.html
  • usr/share/doc/qt/qtdatavisualization/qvalue3daxisformatter.html
  • usr/share/doc/qt/qtdatavisualization/style/
  • usr/share/doc/qt/qtdatavisualization/style/offline-simple.css
  • usr/share/doc/qt/qtdatavisualization/style/offline.css
  • usr/share/doc/qt/qtdbus.qch
  • usr/share/doc/qt/qtdbus/
  • usr/share/doc/qt/qtdbus/examples-dbus.html
  • usr/share/doc/qt/qtdbus/examples-manifest.xml
  • usr/share/doc/qt/qtdbus/images/
  • usr/share/doc/qt/qtdbus/images/arrow_bc.png
  • usr/share/doc/qt/qtdbus/images/bgrContent.png
  • usr/share/doc/qt/qtdbus/images/btn_next.png
  • usr/share/doc/qt/qtdbus/images/btn_prev.png
  • usr/share/doc/qt/qtdbus/images/bullet_dn.png
  • usr/share/doc/qt/qtdbus/images/bullet_sq.png
  • usr/share/doc/qt/qtdbus/images/dbus-chat-example.png
  • usr/share/doc/qt/qtdbus/images/home.png
  • usr/share/doc/qt/qtdbus/images/ico_note.png
  • usr/share/doc/qt/qtdbus/images/ico_note_attention.png
  • usr/share/doc/qt/qtdbus/images/ico_out.png
  • usr/share/doc/qt/qtdbus/images/logo.png
  • usr/share/doc/qt/qtdbus/images/qurl-ftppath.png
  • usr/share/doc/qt/qtdbus/images/remotecontrolledcar-car-example.png
  • usr/share/doc/qt/qtdbus/qdbus.html
  • usr/share/doc/qt/qtdbus/qdbusabstractadaptor-members.html
  • usr/share/doc/qt/qtdbus/qdbusabstractadaptor-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbusabstractadaptor.html
  • usr/share/doc/qt/qtdbus/qdbusabstractinterface-members.html
  • usr/share/doc/qt/qtdbus/qdbusabstractinterface-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbusabstractinterface.html
  • usr/share/doc/qt/qtdbus/qdbusargument-members.html
  • usr/share/doc/qt/qtdbus/qdbusargument.html
  • usr/share/doc/qt/qtdbus/qdbusconnection-members.html
  • usr/share/doc/qt/qtdbus/qdbusconnection-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbusconnection.html
  • usr/share/doc/qt/qtdbus/qdbusconnectioninterface-members.html
  • usr/share/doc/qt/qtdbus/qdbusconnectioninterface-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbusconnectioninterface.html
  • usr/share/doc/qt/qtdbus/qdbuscontext-members.html
  • usr/share/doc/qt/qtdbus/qdbuscontext.html
  • usr/share/doc/qt/qtdbus/qdbusdeclaringsignals.html
  • usr/share/doc/qt/qtdbus/qdbusdeclaringslots.html
  • usr/share/doc/qt/qtdbus/qdbuserror-members.html
  • usr/share/doc/qt/qtdbus/qdbuserror.html
  • usr/share/doc/qt/qtdbus/qdbusinterface-members.html
  • usr/share/doc/qt/qtdbus/qdbusinterface-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbusinterface.html
  • usr/share/doc/qt/qtdbus/qdbusmessage-members.html
  • usr/share/doc/qt/qtdbus/qdbusmessage.html
  • usr/share/doc/qt/qtdbus/qdbusobjectpath-members.html
  • usr/share/doc/qt/qtdbus/qdbusobjectpath.html
  • usr/share/doc/qt/qtdbus/qdbuspendingcall-members.html
  • usr/share/doc/qt/qtdbus/qdbuspendingcall.html
  • usr/share/doc/qt/qtdbus/qdbuspendingcallwatcher-members.html
  • usr/share/doc/qt/qtdbus/qdbuspendingcallwatcher-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbuspendingcallwatcher.html
  • usr/share/doc/qt/qtdbus/qdbuspendingreply-members.html
  • usr/share/doc/qt/qtdbus/qdbuspendingreply.html
  • usr/share/doc/qt/qtdbus/qdbusreply-members.html
  • usr/share/doc/qt/qtdbus/qdbusreply.html
  • usr/share/doc/qt/qtdbus/qdbusserver-members.html
  • usr/share/doc/qt/qtdbus/qdbusserver-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbusserver.html
  • usr/share/doc/qt/qtdbus/qdbusservicewatcher-members.html
  • usr/share/doc/qt/qtdbus/qdbusservicewatcher-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbusservicewatcher.html
  • usr/share/doc/qt/qtdbus/qdbussignature-members.html
  • usr/share/doc/qt/qtdbus/qdbussignature.html
  • usr/share/doc/qt/qtdbus/qdbustypesystem.html
  • usr/share/doc/qt/qtdbus/qdbusunixfiledescriptor-members.html
  • usr/share/doc/qt/qtdbus/qdbusunixfiledescriptor.html
  • usr/share/doc/qt/qtdbus/qdbusvariant-members.html
  • usr/share/doc/qt/qtdbus/qdbusvariant.html
  • usr/share/doc/qt/qtdbus/qdbusviewer.html
  • usr/share/doc/qt/qtdbus/qdbusvirtualobject-members.html
  • usr/share/doc/qt/qtdbus/qdbusvirtualobject-obsolete.html
  • usr/share/doc/qt/qtdbus/qdbusvirtualobject.html
  • usr/share/doc/qt/qtdbus/qdbusxml2cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-attribution-libdbus-1-headers.html
  • usr/share/doc/qt/qtdbus/qtdbus-chat-chat-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-chat-chat-h.html
  • usr/share/doc/qt/qtdbus/qtdbus-chat-chat-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-chat-chatmainwindow-ui.html
  • usr/share/doc/qt/qtdbus/qtdbus-chat-chatsetnickname-ui.html
  • usr/share/doc/qt/qtdbus/qtdbus-chat-example.html
  • usr/share/doc/qt/qtdbus/qtdbus-chat-org-example-chat-xml.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-complexping-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-complexping-h.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-complexping-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-complexpingpong-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-complexpong-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-complexpong-h.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-complexpong-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-example.html
  • usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-ping-common-h.html
  • usr/share/doc/qt/qtdbus/qtdbus-index.html
  • usr/share/doc/qt/qtdbus/qtdbus-listnames-example.html
  • usr/share/doc/qt/qtdbus/qtdbus-listnames-listnames-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-listnames-listnames-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-module.html
  • usr/share/doc/qt/qtdbus/qtdbus-pingpong-example.html
  • usr/share/doc/qt/qtdbus/qtdbus-pingpong-ping-common-h.html
  • usr/share/doc/qt/qtdbus/qtdbus-pingpong-ping-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-pingpong-ping-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-pingpong-pingpong-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-pingpong-pong-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-pingpong-pong-h.html
  • usr/share/doc/qt/qtdbus/qtdbus-pingpong-pong-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-car-car-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-car-car-h.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-car-car-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-car-car-xml.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-car-main-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-controller-car-xml.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-controller-controller-cpp.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-controller-controller-h.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-controller-controller-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-controller-controller-ui.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-example.html
  • usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-remotecontrolledcar-pro.html
  • usr/share/doc/qt/qtdbus/qtdbus.index
  • usr/share/doc/qt/qtdbus/qtdbus.qhp
  • usr/share/doc/qt/qtdbus/qtdbus.qhp.sha1
  • usr/share/doc/qt/qtdbus/style/
  • usr/share/doc/qt/qtdbus/style/offline-simple.css
  • usr/share/doc/qt/qtdbus/style/offline.css
  • usr/share/doc/qt/qtdbus/usingadaptors.html
  • usr/share/doc/qt/qtdesigner.qch
  • usr/share/doc/qt/qtdesigner/
  • usr/share/doc/qt/qtdesigner/designer-buddy-mode.html
  • usr/share/doc/qt/qtdesigner/designer-connection-mode.html
  • usr/share/doc/qt/qtdesigner/designer-creating-custom-widgets-extensions.html
  • usr/share/doc/qt/qtdesigner/designer-creating-custom-widgets.html
  • usr/share/doc/qt/qtdesigner/designer-creating-mainwindows.html
  • usr/share/doc/qt/qtdesigner/designer-customizing-forms.html
  • usr/share/doc/qt/qtdesigner/designer-editing-mode.html
  • usr/share/doc/qt/qtdesigner/designer-layouts.html
  • usr/share/doc/qt/qtdesigner/designer-preview.html
  • usr/share/doc/qt/qtdesigner/designer-quick-start.html
  • usr/share/doc/qt/qtdesigner/designer-resources.html
  • usr/share/doc/qt/qtdesigner/designer-stylesheet.html
  • usr/share/doc/qt/qtdesigner/designer-tab-order.html
  • usr/share/doc/qt/qtdesigner/designer-to-know.html
  • usr/share/doc/qt/qtdesigner/designer-ui-file-format.html
  • usr/share/doc/qt/qtdesigner/designer-using-a-ui-file.html
  • usr/share/doc/qt/qtdesigner/designer-using-containers.html
  • usr/share/doc/qt/qtdesigner/designer-using-custom-widgets.html
  • usr/share/doc/qt/qtdesigner/designer-widget-mode.html
  • usr/share/doc/qt/qtdesigner/examples-designer.html
  • usr/share/doc/qt/qtdesigner/examples-manifest.xml
  • usr/share/doc/qt/qtdesigner/images/
  • usr/share/doc/qt/qtdesigner/images/addressbook-tutorial-part3-labeled-layout.png
  • usr/share/doc/qt/qtdesigner/images/arrow_bc.png
  • usr/share/doc/qt/qtdesigner/images/bgrContent.png
  • usr/share/doc/qt/qtdesigner/images/btn_next.png
  • usr/share/doc/qt/qtdesigner/images/btn_prev.png
  • usr/share/doc/qt/qtdesigner/images/bullet_dn.png
  • usr/share/doc/qt/qtdesigner/images/bullet_sq.png
  • usr/share/doc/qt/qtdesigner/images/calculatorbuilder-example.png
  • usr/share/doc/qt/qtdesigner/images/calculatorform-example.png
  • usr/share/doc/qt/qtdesigner/images/containerextension-example.png
  • usr/share/doc/qt/qtdesigner/images/customwidgetplugin-example.png
  • usr/share/doc/qt/qtdesigner/images/designer-action-editor.png
  • usr/share/doc/qt/qtdesigner/images/designer-add-files-button.png
  • usr/share/doc/qt/qtdesigner/images/designer-add-resource-entry-button.png
  • usr/share/doc/qt/qtdesigner/images/designer-adding-dockwidget.png
  • usr/share/doc/qt/qtdesigner/images/designer-adding-menu-action.png
  • usr/share/doc/qt/qtdesigner/images/designer-adding-toolbar-action.png
  • usr/share/doc/qt/qtdesigner/images/designer-buddy-making.png
  • usr/share/doc/qt/qtdesigner/images/designer-buddy-mode.png
  • usr/share/doc/qt/qtdesigner/images/designer-buddy-tool.png
  • usr/share/doc/qt/qtdesigner/images/designer-choosing-form.png
  • usr/share/doc/qt/qtdesigner/images/designer-code-viewer.png
  • usr/share/doc/qt/qtdesigner/images/designer-connection-dialog.png
  • usr/share/doc/qt/qtdesigner/images/designer-connection-editing.png
  • usr/share/doc/qt/qtdesigner/images/designer-connection-editor.png
  • usr/share/doc/qt/qtdesigner/images/designer-connection-highlight.png
  • usr/share/doc/qt/qtdesigner/images/designer-connection-making.png
  • usr/share/doc/qt/qtdesigner/images/designer-connection-mode.png
  • usr/share/doc/qt/qtdesigner/images/designer-connection-to-form.png
  • usr/share/doc/qt/qtdesigner/images/designer-connection-tool.png
  • usr/share/doc/qt/qtdesigner/images/designer-containers-dockwidget.png
  • usr/share/doc/qt/qtdesigner/images/designer-containers-frame.png
  • usr/share/doc/qt/qtdesigner/images/designer-containers-groupbox.png
  • usr/share/doc/qt/qtdesigner/images/designer-containers-stackedwidget.png
  • usr/share/doc/qt/qtdesigner/images/designer-containers-tabwidget.png
  • usr/share/doc/qt/qtdesigner/images/designer-containers-toolbox.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-menu-entry1.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-menu-entry2.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-menu-entry3.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-menu-entry4.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-menu1.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-menu2.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-menu3.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-menu4.png
  • usr/share/doc/qt/qtdesigner/images/designer-creating-toolbar.png
  • usr/share/doc/qt/qtdesigner/images/designer-dialog-preview.png
  • usr/share/doc/qt/qtdesigner/images/designer-dragging-onto-form.png
  • usr/share/doc/qt/qtdesigner/images/designer-edit-resource.png
  • usr/share/doc/qt/qtdesigner/images/designer-edit-resources-button.png
  • usr/share/doc/qt/qtdesigner/images/designer-editing-mode.png
  • usr/share/doc/qt/qtdesigner/images/designer-english-dialog.png
  • usr/share/doc/qt/qtdesigner/images/designer-file-menu.png
  • usr/share/doc/qt/qtdesigner/images/designer-form-layout-cleanlooks.png
  • usr/share/doc/qt/qtdesigner/images/designer-form-layout-macintosh.png
  • usr/share/doc/qt/qtdesigner/images/designer-form-layout-windowsXP.png
  • usr/share/doc/qt/qtdesigner/images/designer-form-layout.png
  • usr/share/doc/qt/qtdesigner/images/designer-form-layoutfunction.png
  • usr/share/doc/qt/qtdesigner/images/designer-form-settings.png
  • usr/share/doc/qt/qtdesigner/images/designer-form-viewcode.png
  • usr/share/doc/qt/qtdesigner/images/designer-french-dialog.png
  • usr/share/doc/qt/qtdesigner/images/designer-layout-inserting.png
  • usr/share/doc/qt/qtdesigner/images/designer-main-window.png
  • usr/share/doc/qt/qtdesigner/images/designer-manual-containerextension.png
  • usr/share/doc/qt/qtdesigner/images/designer-manual-membersheetextension.png
  • usr/share/doc/qt/qtdesigner/images/designer-manual-propertysheetextension.png
  • usr/share/doc/qt/qtdesigner/images/designer-manual-taskmenuextension.png
  • usr/share/doc/qt/qtdesigner/images/designer-multiple-screenshot.png
  • usr/share/doc/qt/qtdesigner/images/designer-object-inspector.png
  • usr/share/doc/qt/qtdesigner/images/designer-preview-deviceskin-selection.png
  • usr/share/doc/qt/qtdesigner/images/designer-preview-style-selection.png
  • usr/share/doc/qt/qtdesigner/images/designer-preview-style.png
  • usr/share/doc/qt/qtdesigner/images/designer-preview-stylesheet.png
  • usr/share/doc/qt/qtdesigner/images/designer-promoting-widgets.png
  • usr/share/doc/qt/qtdesigner/images/designer-property-editor-add-dynamic.png
  • usr/share/doc/qt/qtdesigner/images/designer-property-editor-configure.png
  • usr/share/doc/qt/qtdesigner/images/designer-property-editor-remove-dynamic.png
  • usr/share/doc/qt/qtdesigner/images/designer-property-editor-toolbar.png
  • usr/share/doc/qt/qtdesigner/images/designer-property-editor.png
  • usr/share/doc/qt/qtdesigner/images/designer-reload-resources-button.png
  • usr/share/doc/qt/qtdesigner/images/designer-remove-resource-entry-button.png
  • usr/share/doc/qt/qtdesigner/images/designer-removing-toolbar-action.png
  • usr/share/doc/qt/qtdesigner/images/designer-resource-browser.png
  • usr/share/doc/qt/qtdesigner/images/designer-resource-selector.png
  • usr/share/doc/qt/qtdesigner/images/designer-resources-editing.png
  • usr/share/doc/qt/qtdesigner/images/designer-resources-using.png
  • usr/share/doc/qt/qtdesigner/images/designer-screenshot.png
  • usr/share/doc/qt/qtdesigner/images/designer-selecting-widget.png
  • usr/share/doc/qt/qtdesigner/images/designer-set-layout.png
  • usr/share/doc/qt/qtdesigner/images/designer-set-layout2.png
  • usr/share/doc/qt/qtdesigner/images/designer-splitter-layout.png
  • usr/share/doc/qt/qtdesigner/images/designer-stylesheet-options.png
  • usr/share/doc/qt/qtdesigner/images/designer-stylesheet-usage.png
  • usr/share/doc/qt/qtdesigner/images/designer-tab-order-mode.png
  • usr/share/doc/qt/qtdesigner/images/designer-tab-order-tool.png
  • usr/share/doc/qt/qtdesigner/images/designer-widget-box.png
  • usr/share/doc/qt/qtdesigner/images/designer-widget-morph.png
  • usr/share/doc/qt/qtdesigner/images/designer-widget-tool.png
  • usr/share/doc/qt/qtdesigner/images/directapproach-calculatorform.png
  • usr/share/doc/qt/qtdesigner/images/home.png
  • usr/share/doc/qt/qtdesigner/images/ico_note.png
  • usr/share/doc/qt/qtdesigner/images/ico_note_attention.png
  • usr/share/doc/qt/qtdesigner/images/ico_out.png
  • usr/share/doc/qt/qtdesigner/images/logo.png
  • usr/share/doc/qt/qtdesigner/images/qtdesignerextensions.png
  • usr/share/doc/qt/qtdesigner/images/qtdesignerscreenshot.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-arrangement.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-configure-connection1.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-configure-connection2.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-final-layout.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-form-gridLayout.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-no-toplevel-layout.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-property-editing.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-screenshot.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-selectForLayout.png
  • usr/share/doc/qt/qtdesigner/images/rgbController-signalsAndSlots.png
  • usr/share/doc/qt/qtdesigner/images/taskmenuextension-dialog.png
  • usr/share/doc/qt/qtdesigner/images/taskmenuextension-example-faded.png
  • usr/share/doc/qt/qtdesigner/images/taskmenuextension-menu.png
  • usr/share/doc/qt/qtdesigner/images/worldtimeclock-connection.png
  • usr/share/doc/qt/qtdesigner/images/worldtimeclock-signalandslot.png
  • usr/share/doc/qt/qtdesigner/images/worldtimeclockbuilder-example.png
  • usr/share/doc/qt/qtdesigner/images/worldtimeclockplugin-example.png
  • usr/share/doc/qt/qtdesigner/qabstractextensionfactory-members.html
  • usr/share/doc/qt/qtdesigner/qabstractextensionfactory.html
  • usr/share/doc/qt/qtdesigner/qabstractextensionmanager-members.html
  • usr/share/doc/qt/qtdesigner/qabstractextensionmanager.html
  • usr/share/doc/qt/qtdesigner/qabstractformbuilder-members.html
  • usr/share/doc/qt/qtdesigner/qabstractformbuilder.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actiondata-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actiondata.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actioneditor-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actioneditor.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actioninsertioncommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actioninsertioncommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actionlistview-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actionlistview.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actionmodel-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actionmodel.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actionrepositorymimedata-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actionrepositorymimedata.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actiontreeview-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actiontreeview.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actionview-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-actionview.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addactioncommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addactioncommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addconnectioncommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addconnectioncommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addcontainerwidgetpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addcontainerwidgetpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-adddockwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-adddockwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-adddynamicpropertycommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-adddynamicpropertycommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addmenuactioncommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addmenuactioncommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addstackedwidgetpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addstackedwidgetpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addtabpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addtabpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addtoolbarcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addtoolbarcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addtoolboxpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-addtoolboxpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-adjustwidgetsizecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-adjustwidgetsizecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-breaklayoutcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-breaklayoutcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-cecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-cecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-cetypes-endpoint-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-cetypes-endpoint.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-cetypes-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-cetypes.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changecurrentpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changecurrentpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changeformlayoutitemrolecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changeformlayoutitemrolecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changelayoutitemgeometry-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changelayoutitemgeometry.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changelistcontentscommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changelistcontentscommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changetablecontentscommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changetablecontentscommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changetreecontentscommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changetreecontentscommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changezordercommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-changezordercommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-codedialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-codedialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-connection-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-connection.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-connectionedit-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-connectionedit.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-containerwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-containerwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-createmenubarcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-createmenubarcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-createstatusbarcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-createstatusbarcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-createsubmenucommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-createsubmenucommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-csshighlighter-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-csshighlighter.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-cursorselectionstate-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-cursorselectionstate.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deleteconnectionscommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deleteconnectionscommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletecontainerwidgetpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletecontainerwidgetpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletemenubarcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletemenubarcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletestackedwidgetpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletestackedwidgetpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletestatusbarcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletestatusbarcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletetabpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletetabpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletetoolbarcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletetoolbarcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletetoolboxpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletetoolboxpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletewidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deletewidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-demotefromcustomwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-demotefromcustomwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-designericoncache-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-designericoncache.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-designermetaenum-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-designermetaenum.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-designermetaflags-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-designermetaflags.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-designerpixmapcache-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-designerpixmapcache.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deviceprofile-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-deviceprofile.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-dialoggui-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-dialoggui.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-dockwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-dockwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-extensionfactory-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-extensionfactory.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-formbuilderclipboard-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-formbuilderclipboard.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-formlayoutmenu-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-formlayoutmenu.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-formwindowbase-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-formwindowbase.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-grid-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-grid.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-gridpanel-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-gridpanel.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-htmlhighlighter-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-htmlhighlighter.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-iconselector-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-iconselector.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-iconthemeeditor-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-iconthemeeditor.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-insertactionintocommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-insertactionintocommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-insertwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-insertwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-invisiblewidget-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-invisiblewidget.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-itemdata-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-itemdata.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-languageresourcedialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-languageresourcedialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layoutalignmentcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layoutalignmentcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layoutcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layoutcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layouthelper-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layouthelper.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layoutinfo-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layoutinfo.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layoutproperties-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-layoutproperties.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-listcontents-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-listcontents.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-lowerwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-lowerwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-managewidgetcommandhelper-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-managewidgetcommandhelper.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-menuactioncommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-menuactioncommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-metadatabase-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-metadatabase.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-metadatabaseitem-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-metadatabaseitem.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-metaenum-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-metaenum.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-morphlayoutcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-morphlayoutcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-morphmenu-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-morphmenu.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-movestackedwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-movestackedwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-movetabpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-movetabpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-movetoolboxpagecommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-movetoolboxpagecommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-newactiondialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-newactiondialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-newformwidget-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-newformwidget.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-newformwidgetformbuilder-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-newformwidgetformbuilder.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-newpromotedclasspanel-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-newpromotedclasspanel.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-orderdialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-orderdialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-plaintexteditordialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-plaintexteditordialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-plugindialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-plugindialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-previewconfiguration-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-previewconfiguration.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-previewconfigurationwidget-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-previewconfigurationwidget.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-previewmanager-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-previewmanager.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-promotetocustomwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-promotetocustomwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-promotionmodel-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-promotionmodel-modeldata-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-promotionmodel-modeldata.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-promotionmodel.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-promotiontaskmenu-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-promotiontaskmenu.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertyhelper-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertyhelper.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertylineedit-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertylineedit.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertylistcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertylistcommand-propertydescription-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertylistcommand-propertydescription.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertylistcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetenumvalue-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetenumvalue.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetflagvalue-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetflagvalue.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheeticonvalue-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheeticonvalue.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetkeysequencevalue-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetkeysequencevalue.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetpixmapvalue-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetpixmapvalue.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetstringlistvalue-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetstringlistvalue.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetstringvalue-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheetstringvalue.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheettranslatabledata-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-propertysheettranslatabledata.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerdnditem-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerdnditem.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformbuilder-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformbuilder.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformeditorcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformeditorcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformwindowcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformwindowcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformwindowmanager-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformwindowmanager-obsolete.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformwindowmanager.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerintrospection-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerintrospection.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignermimedata-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignermimedata.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerobjectinspector-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerobjectinspector.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerpromotion-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerpromotion.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerpromotiondialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerpromotiondialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerpropertyeditor-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerpropertyeditor.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignersharedsettings-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignersharedsettings.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignertaskmenu-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignertaskmenu.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerwidgetbox-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerwidgetbox.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerwidgetitem-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerwidgetitem.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerwidgetiteminstaller-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerwidgetiteminstaller.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qeditorformbuilder-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qeditorformbuilder.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qlayoutsupport-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qlayoutsupport.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qsimpleresource-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-qsimpleresource.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-raisewidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-raisewidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removeactioncommand-actiondataitem-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removeactioncommand-actiondataitem.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removeactioncommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removeactioncommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removeactionfromcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removeactionfromcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removedynamicpropertycommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removedynamicpropertycommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removemenuactioncommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-removemenuactioncommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-reparentwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-reparentwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-resetpropertycommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-resetpropertycommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-richtexteditordialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-richtexteditordialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-selection-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-selection.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-selectsignaldialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-selectsignaldialog-method-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-selectsignaldialog-method.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-selectsignaldialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-setpropertycommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-setpropertycommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-sheetdelegate-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-sheetdelegate.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-signalslotdialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-signalslotdialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-signalslotdialogdata-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-signalslotdialogdata.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-signaturemodel-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-signaturemodel.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-signaturepanel-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-signaturepanel.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-simplifylayoutcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-simplifylayoutcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-specialmenuaction-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-specialmenuaction.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-stackedwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-stackedwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-stylesheeteditor-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-stylesheeteditor.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-stylesheeteditordialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-stylesheeteditordialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-stylesheetpropertyeditordialog-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-stylesheetpropertyeditordialog.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-sub-qtdesigner.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-tablewidgetcontents-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-tablewidgetcontents.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-tabordercommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-tabordercommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-tabwidgetcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-tabwidgetcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-textpropertyeditor-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-textpropertyeditor.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-toolbareventfilter-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-toolbareventfilter.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-toolboxcommand-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-toolboxcommand.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-treewidgetcontents-itemcontents-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-treewidgetcontents-itemcontents.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-treewidgetcontents-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-treewidgetcontents.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-updateblocker-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-updateblocker.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-widgetdatabase-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-widgetdatabase.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-widgetdatabaseitem-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-widgetdatabaseitem.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-widgetfactory-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-widgetfactory.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-zoommenu-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-zoommenu.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-zoomproxywidget-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-zoomproxywidget.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-zoomview-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-zoomview.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-zoomwidget-members.html
  • usr/share/doc/qt/qtdesigner/qdesigner-internal-zoomwidget.html
  • usr/share/doc/qt/qtdesigner/qdesigneractioneditorinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesigneractioneditorinterface-obsolete.html
  • usr/share/doc/qt/qtdesigner/qdesigneractioneditorinterface.html
  • usr/share/doc/qt/qtdesigner/qdesignercustomwidgetcollectioninterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignercustomwidgetcollectioninterface.html
  • usr/share/doc/qt/qtdesigner/qdesignercustomwidgetinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignercustomwidgetinterface.html
  • usr/share/doc/qt/qtdesigner/qdesignerdynamicpropertysheetextension-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerdynamicpropertysheetextension.html
  • usr/share/doc/qt/qtdesigner/qdesignerformeditorinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerformeditorinterface-obsolete.html
  • usr/share/doc/qt/qtdesigner/qdesignerformeditorinterface.html
  • usr/share/doc/qt/qtdesigner/qdesignerformwindowcursorinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerformwindowcursorinterface.html
  • usr/share/doc/qt/qtdesigner/qdesignerformwindowinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerformwindowinterface-obsolete.html
  • usr/share/doc/qt/qtdesigner/qdesignerformwindowinterface.html
  • usr/share/doc/qt/qtdesigner/qdesignerformwindowmanagerinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerformwindowmanagerinterface-obsolete.html
  • usr/share/doc/qt/qtdesigner/qdesignerformwindowmanagerinterface.html
  • usr/share/doc/qt/qtdesigner/qdesignerobjectinspectorinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerobjectinspectorinterface-obsolete.html
  • usr/share/doc/qt/qtdesigner/qdesignerobjectinspectorinterface.html
  • usr/share/doc/qt/qtdesigner/qdesignerpropertyeditorinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerpropertyeditorinterface-obsolete.html
  • usr/share/doc/qt/qtdesigner/qdesignerpropertyeditorinterface.html
  • usr/share/doc/qt/qtdesigner/qdesignerpropertysheetextension-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerpropertysheetextension.html
  • usr/share/doc/qt/qtdesigner/qdesignertaskmenuextension-members.html
  • usr/share/doc/qt/qtdesigner/qdesignertaskmenuextension.html
  • usr/share/doc/qt/qtdesigner/qdesignerwidgetboxinterface-members.html
  • usr/share/doc/qt/qtdesigner/qdesignerwidgetboxinterface-obsolete.html
  • usr/share/doc/qt/qtdesigner/qdesignerwidgetboxinterface.html
  • usr/share/doc/qt/qtdesigner/qextensionfactory-members.html
  • usr/share/doc/qt/qtdesigner/qextensionfactory-obsolete.html
  • usr/share/doc/qt/qtdesigner/qextensionfactory.html
  • usr/share/doc/qt/qtdesigner/qextensionmanager-members.html
  • usr/share/doc/qt/qtdesigner/qextensionmanager-obsolete.html
  • usr/share/doc/qt/qtdesigner/qextensionmanager.html
  • usr/share/doc/qt/qtdesigner/qformbuilder-members.html
  • usr/share/doc/qt/qtdesigner/qformbuilder.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-pro.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-qrc.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-ui.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorbuilder-example.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorbuilder-main-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorform-calculatorform-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorform-calculatorform-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorform-calculatorform-pro.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorform-calculatorform-ui.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorform-example.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-calculatorform-main-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-components.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-containerextension-pro.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-example.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-multipagewidget-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-multipagewidget-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-customwidgetplugin-analogclock-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-customwidgetplugin-analogclock-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-pro.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-customwidgetplugin-example.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-index.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-manual.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-module.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-example.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-taskmenuextension-pro.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-tictactoe-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-tictactoe-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockbuilder-example.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockbuilder-form-ui.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockbuilder-main-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-pro.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-qrc.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockplugin-example.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-cpp.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-h.html
  • usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-pro.html
  • usr/share/doc/qt/qtdesigner/qtdesigner.index
  • usr/share/doc/qt/qtdesigner/qtdesigner.qhp
  • usr/share/doc/qt/qtdesigner/qtdesigner.qhp.sha1
  • usr/share/doc/qt/qtdesigner/style/
  • usr/share/doc/qt/qtdesigner/style/offline-simple.css
  • usr/share/doc/qt/qtdesigner/style/offline.css
  • usr/share/doc/qt/qtdistancefieldgenerator.qch
  • usr/share/doc/qt/qtdistancefieldgenerator/
  • usr/share/doc/qt/qtdistancefieldgenerator/images/
  • usr/share/doc/qt/qtdistancefieldgenerator/images/arrow_bc.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/bgrContent.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/btn_next.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/btn_prev.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/bullet_dn.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/bullet_sq.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/distancefieldgenerator.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/home.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/ico_note.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/ico_note_attention.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/ico_out.png
  • usr/share/doc/qt/qtdistancefieldgenerator/images/logo.png
  • usr/share/doc/qt/qtdistancefieldgenerator/qtdistancefieldgenerator-index.html
  • usr/share/doc/qt/qtdistancefieldgenerator/qtdistancefieldgenerator.index
  • usr/share/doc/qt/qtdistancefieldgenerator/qtdistancefieldgenerator.qhp
  • usr/share/doc/qt/qtdistancefieldgenerator/qtdistancefieldgenerator.qhp.sha1
  • usr/share/doc/qt/qtdistancefieldgenerator/style/
  • usr/share/doc/qt/qtdistancefieldgenerator/style/offline-simple.css
  • usr/share/doc/qt/qtdistancefieldgenerator/style/offline.css
  • usr/share/doc/qt/qtdoc.qch
  • usr/share/doc/qt/qtdoc/
  • usr/share/doc/qt/qtdoc/accelerators.html
  • usr/share/doc/qt/qtdoc/accessibility.html
  • usr/share/doc/qt/qtdoc/accessible-qtquick.html
  • usr/share/doc/qt/qtdoc/accessible-qwidget.html
  • usr/share/doc/qt/qtdoc/accessible.html
  • usr/share/doc/qt/qtdoc/activeqt-idc.html
  • usr/share/doc/qt/qtdoc/activeqt-testcon.html
  • usr/share/doc/qt/qtdoc/activeqt.html
  • usr/share/doc/qt/qtdoc/all-examples.html
  • usr/share/doc/qt/qtdoc/android-3rdparty-libs.html
  • usr/share/doc/qt/qtdoc/android-getting-started.html
  • usr/share/doc/qt/qtdoc/android-openssl-support.html
  • usr/share/doc/qt/qtdoc/android-platform-notes.html
  • usr/share/doc/qt/qtdoc/android-publishing-to-googleplay.html
  • usr/share/doc/qt/qtdoc/android-runtime-licensing-notes.html
  • usr/share/doc/qt/qtdoc/android-services.html
  • usr/share/doc/qt/qtdoc/android.html
  • usr/share/doc/qt/qtdoc/annotated.html
  • usr/share/doc/qt/qtdoc/appicon.html
  • usr/share/doc/qt/qtdoc/atomic-operations.html
  • usr/share/doc/qt/qtdoc/best-practices.html
  • usr/share/doc/qt/qtdoc/bughowto.html
  • usr/share/doc/qt/qtdoc/build-sources.html
  • usr/share/doc/qt/qtdoc/classes.html
  • usr/share/doc/qt/qtdoc/classesandfunctions.html
  • usr/share/doc/qt/qtdoc/cmake-manual.html
  • usr/share/doc/qt/qtdoc/commerciallicense.html
  • usr/share/doc/qt/qtdoc/configure-options.html
  • usr/share/doc/qt/qtdoc/debug.html
  • usr/share/doc/qt/qtdoc/demos-manifest.xml
  • usr/share/doc/qt/qtdoc/deployment-android.html
  • usr/share/doc/qt/qtdoc/deployment-plugins.html
  • usr/share/doc/qt/qtdoc/deployment.html
  • usr/share/doc/qt/qtdoc/desktop-integration.html
  • usr/share/doc/qt/qtdoc/embedded-linux.html
  • usr/share/doc/qt/qtdoc/examples-activeqt.html
  • usr/share/doc/qt/qtdoc/examples-android.html
  • usr/share/doc/qt/qtdoc/examples-animation.html
  • usr/share/doc/qt/qtdoc/examples-draganddrop.html
  • usr/share/doc/qt/qtdoc/examples-gestures.html
  • usr/share/doc/qt/qtdoc/examples-ios.html
  • usr/share/doc/qt/qtdoc/examples-ipc.html
  • usr/share/doc/qt/qtdoc/examples-layouts.html
  • usr/share/doc/qt/qtdoc/examples-license.html
  • usr/share/doc/qt/qtdoc/examples-manifest.xml
  • usr/share/doc/qt/qtdoc/examples-sql.html
  • usr/share/doc/qt/qtdoc/examples-statemachine.html
  • usr/share/doc/qt/qtdoc/examples-threadandconcurrent.html
  • usr/share/doc/qt/qtdoc/examples-widgets-tools.html
  • usr/share/doc/qt/qtdoc/examples-xml.html
  • usr/share/doc/qt/qtdoc/exceptionsafety.html
  • usr/share/doc/qt/qtdoc/fdl.html
  • usr/share/doc/qt/qtdoc/functions.html
  • usr/share/doc/qt/qtdoc/gettingstarted.html
  • usr/share/doc/qt/qtdoc/gpl.html
  • usr/share/doc/qt/qtdoc/groups.html
  • usr/share/doc/qt/qtdoc/hierarchy.html
  • usr/share/doc/qt/qtdoc/highdpi.html
  • usr/share/doc/qt/qtdoc/i18n-plural-rules.html
  • usr/share/doc/qt/qtdoc/i18n-source-translation.html
  • usr/share/doc/qt/qtdoc/i18n.html
  • usr/share/doc/qt/qtdoc/images/
  • usr/share/doc/qt/qtdoc/images/I5jasWrsxT0.jpg
  • usr/share/doc/qt/qtdoc/images/accessibleobjecttree.png
  • usr/share/doc/qt/qtdoc/images/activeqt-examples.png
  • usr/share/doc/qt/qtdoc/images/addalarms.png
  • usr/share/doc/qt/qtdoc/images/alarms2.png
  • usr/share/doc/qt/qtdoc/images/alarms3.png
  • usr/share/doc/qt/qtdoc/images/animatedtiles_snapshot.png
  • usr/share/doc/qt/qtdoc/images/animation-examples.png
  • usr/share/doc/qt/qtdoc/images/applicationwindow.png
  • usr/share/doc/qt/qtdoc/images/arrow_bc.png
  • usr/share/doc/qt/qtdoc/images/bgrContent.png
  • usr/share/doc/qt/qtdoc/images/btn_next.png
  • usr/share/doc/qt/qtdoc/images/btn_prev.png
  • usr/share/doc/qt/qtdoc/images/bullet_dn.png
  • usr/share/doc/qt/qtdoc/images/bullet_sq.png
  • usr/share/doc/qt/qtdoc/images/coffee_machine_emptycup.png
  • usr/share/doc/qt/qtdoc/images/coffee_machine_modify.png
  • usr/share/doc/qt/qtdoc/images/coffee_machine_overview.png
  • usr/share/doc/qt/qtdoc/images/coffee_machine_selection.png
  • usr/share/doc/qt/qtdoc/images/controlstexteditor_designer.png
  • usr/share/doc/qt/qtdoc/images/controlstexteditor_main.png
  • usr/share/doc/qt/qtdoc/images/controlstexteditor_navigator.png
  • usr/share/doc/qt/qtdoc/images/controlstexteditor_newproperties.png
  • usr/share/doc/qt/qtdoc/images/controlstexteditor_openproperties.png
  • usr/share/doc/qt/qtdoc/images/controlstexteditor_rowproperties.png
  • usr/share/doc/qt/qtdoc/images/deployment-mac-application.png
  • usr/share/doc/qt/qtdoc/images/deployment-mac-bundlestructure.png
  • usr/share/doc/qt/qtdoc/images/deployment-windows-depends.png
  • usr/share/doc/qt/qtdoc/images/detailscreen.png
  • usr/share/doc/qt/qtdoc/images/draganddrop-examples.png
  • usr/share/doc/qt/qtdoc/images/flickr_application.png
  • usr/share/doc/qt/qtdoc/images/home.png
  • usr/share/doc/qt/qtdoc/images/ico_note.png
  • usr/share/doc/qt/qtdoc/images/ico_note_attention.png
  • usr/share/doc/qt/qtdoc/images/ico_out.png
  • usr/share/doc/qt/qtdoc/images/icon_QtCreator_78x78px.png
  • usr/share/doc/qt/qtdoc/images/icon_Qt_78x78px.png
  • usr/share/doc/qt/qtdoc/images/icon_Tools.png
  • usr/share/doc/qt/qtdoc/images/kernel-settings.png
  • usr/share/doc/qt/qtdoc/images/layout-examples.png
  • usr/share/doc/qt/qtdoc/images/logo.png
  • usr/share/doc/qt/qtdoc/images/mainscreen.png
  • usr/share/doc/qt/qtdoc/images/mob-idle.png
  • usr/share/doc/qt/qtdoc/images/ok.png
  • usr/share/doc/qt/qtdoc/images/open-project.png
  • usr/share/doc/qt/qtdoc/images/project-view-2.png
  • usr/share/doc/qt/qtdoc/images/project-view.png
  • usr/share/doc/qt/qtdoc/images/project-wizard.png
  • usr/share/doc/qt/qtdoc/images/qml-extending-types.gif
  • usr/share/doc/qt/qtdoc/images/qml-uses-animation.png
  • usr/share/doc/qt/qtdoc/images/qml-uses-integratingjs.png
  • usr/share/doc/qt/qtdoc/images/qml-uses-layouts-anchors.png
  • usr/share/doc/qt/qtdoc/images/qml-uses-layouts-direct.png
  • usr/share/doc/qt/qtdoc/images/qml-uses-layouts-positioners.png
  • usr/share/doc/qt/qtdoc/images/qml-uses-text.png
  • usr/share/doc/qt/qtdoc/images/qml-uses-visual-opacity.png
  • usr/share/doc/qt/qtdoc/images/qml-uses-visual-rectangles.png
  • usr/share/doc/qt/qtdoc/images/qml-uses-visual-transforms.png
  • usr/share/doc/qt/qtdoc/images/qt-codesample.png
  • usr/share/doc/qt/qtdoc/images/qt-creator-gs.png
  • usr/share/doc/qt/qtdoc/images/qt-embedded-fontfeatures.png
  • usr/share/doc/qt/qtdoc/images/qt5_everywhere_demo.jpg
  • usr/share/doc/qt/qtdoc/images/qt5_graphicaleffects.jpg
  • usr/share/doc/qt/qtdoc/images/qt5_particles.jpg
  • usr/share/doc/qt/qtdoc/images/qt5_shadereffect.jpg
  • usr/share/doc/qt/qtdoc/images/qt5_video.jpg
  • usr/share/doc/qt/qtdoc/images/qt5_widgets.jpg
  • usr/share/doc/qt/qtdoc/images/qtcreator-run.png
  • usr/share/doc/qt/qtdoc/images/qtlocation-mapviewer-demo.jpg
  • usr/share/doc/qt/qtdoc/images/qtpositioning_weatherinfo_ex.jpg
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-calqlatr.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-clocks-small.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-1.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-2.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-3.jpg
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-4.jpg
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-5.jpg
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-6.jpg
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-photosurface-small.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-photoviewer-small.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-rssnews-small.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-samegame-med-1.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-samegame-med-2.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-stocqt.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-tweetsearch-med-1.png
  • usr/share/doc/qt/qtdoc/images/qtquick-demo-tweetsearch-med-2.png
  • usr/share/doc/qt/qtdoc/images/qtquickcontrols2-material.png
  • usr/share/doc/qt/qtdoc/images/qtsensors_accelbubble_ex.jpg
  • usr/share/doc/qt/qtdoc/images/qtwebengine_quicknanobrowser.jpg
  • usr/share/doc/qt/qtdoc/images/scalability-gridlayout.png
  • usr/share/doc/qt/qtdoc/images/select-item-to-add.png
  • usr/share/doc/qt/qtdoc/images/session.png
  • usr/share/doc/qt/qtdoc/images/sql-examples.png
  • usr/share/doc/qt/qtdoc/images/thread-examples.png
  • usr/share/doc/qt/qtdoc/images/threadsandobjects.png
  • usr/share/doc/qt/qtdoc/images/threadvisual-example.png
  • usr/share/doc/qt/qtdoc/images/tool-examples.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/images/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-edge-left.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-edge-right.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-grip.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/arrow.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/background.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/center.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/clock-night.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/clock.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/hour.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/minute.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/quit.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/second.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/coffee_cup_large.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/coffee_cup_outline.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_back.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_coverplate.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_front.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_coffee.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_foam.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_milk.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Americano.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Espresso.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Latte.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Macchiato.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/cappucino.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/coffee.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/milk.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/sugar.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/back/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/back/white.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/go/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/go/white.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/line.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/background.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb-action.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb-idle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/button-help.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/button-play.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/catch-action.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/catch.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/cloud.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/currency.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-bomb.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-factory.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-melee.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-pointer.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-shooter.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory-action.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory-idle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/grid.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/help.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/lifes.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo-bubble.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo-fish.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee-action.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee-idle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/mob-idle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/mob.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/points.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/projectile-action.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/projectile.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/scores.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter-action.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter-idle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/sunlight.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-1.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-2.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-3.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-blank.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-gameover.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-go.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/wave.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photosurface/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photosurface/resources/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photosurface/resources/folder.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photosurface/resources/icon.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/box-shadow.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/busy.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/cardboard.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Asia.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Business.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Entertainment.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Europe.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Health.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Politics.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Science.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Sports.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Technology.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/TopStories.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/USNational.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/World.jpg
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/btn_close.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/busy.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/scrollbar.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/background-puzzle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/background.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bar.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/blue-puzzle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/blue.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bubble-highscore.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bubble-puzzle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-1.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-2.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-3.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-4.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-new.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-menu.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-puzzle-next.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-quit.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/green-puzzle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/green.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-fail.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-ok.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-time.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-a.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-e.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-g.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-m.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-s.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-brick.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-paint.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-smoke.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/red-puzzle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/red.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-highscore-new.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-highscore.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-no-winner.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1-go.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1-won.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2-go.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2-won.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/yellow-puzzle.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/yellow.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/images/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/images/icon-left-arrow.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/images/wheel-touch.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/images/wheel.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/anonymous.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/bird-anim-sprites.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-clear.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-loading.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-refresh.png
  • usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-search.png
  • usr/share/doc/qt/qtdoc/images/xml-examples.png
  • usr/share/doc/qt/qtdoc/index.html
  • usr/share/doc/qt/qtdoc/integrity-building-monolith.html
  • usr/share/doc/qt/qtdoc/integrity-building-qt-for-imx6quad-board.html
  • usr/share/doc/qt/qtdoc/integrity-building-u-boot-image.html
  • usr/share/doc/qt/qtdoc/integrity-creating-bootable-sd-card.html
  • usr/share/doc/qt/qtdoc/integrity-installing-dependencies.html
  • usr/share/doc/qt/qtdoc/integrity-monolith-project-tutorial.html
  • usr/share/doc/qt/qtdoc/integrity-preparing-bsp-for-imx6quad-board.html
  • usr/share/doc/qt/qtdoc/integrity-preparing-u-boot.html
  • usr/share/doc/qt/qtdoc/integrity.html
  • usr/share/doc/qt/qtdoc/internationalization.html
  • usr/share/doc/qt/qtdoc/ios-building-from-source.html
  • usr/share/doc/qt/qtdoc/ios-platform-notes.html
  • usr/share/doc/qt/qtdoc/ios.html
  • usr/share/doc/qt/qtdoc/ipc.html
  • usr/share/doc/qt/qtdoc/known-issues.html
  • usr/share/doc/qt/qtdoc/lgpl.html
  • usr/share/doc/qt/qtdoc/license-changes.html
  • usr/share/doc/qt/qtdoc/licenses-used-in-qt.html
  • usr/share/doc/qt/qtdoc/licensing.html
  • usr/share/doc/qt/qtdoc/linux-building.html
  • usr/share/doc/qt/qtdoc/linux-deployment.html
  • usr/share/doc/qt/qtdoc/linux-issues.html
  • usr/share/doc/qt/qtdoc/linux-requirements.html
  • usr/share/doc/qt/qtdoc/linux.html
  • usr/share/doc/qt/qtdoc/macos-building.html
  • usr/share/doc/qt/qtdoc/macos-deployment.html
  • usr/share/doc/qt/qtdoc/macos-issues.html
  • usr/share/doc/qt/qtdoc/macos.html
  • usr/share/doc/qt/qtdoc/mobiledevelopment.html
  • usr/share/doc/qt/qtdoc/moc.html
  • usr/share/doc/qt/qtdoc/modules-cpp.html
  • usr/share/doc/qt/qtdoc/modules-qml.html
  • usr/share/doc/qt/qtdoc/modules.html
  • usr/share/doc/qt/qtdoc/namespaces.html
  • usr/share/doc/qt/qtdoc/newclasses51.html
  • usr/share/doc/qt/qtdoc/newclasses510.html
  • usr/share/doc/qt/qtdoc/newclasses511.html
  • usr/share/doc/qt/qtdoc/newclasses512.html
  • usr/share/doc/qt/qtdoc/newclasses52.html
  • usr/share/doc/qt/qtdoc/newclasses53.html
  • usr/share/doc/qt/qtdoc/newclasses54.html
  • usr/share/doc/qt/qtdoc/newclasses55.html
  • usr/share/doc/qt/qtdoc/newclasses56.html
  • usr/share/doc/qt/qtdoc/newclasses57.html
  • usr/share/doc/qt/qtdoc/newclasses58.html
  • usr/share/doc/qt/qtdoc/newclasses59.html
  • usr/share/doc/qt/qtdoc/obsoleteclasses.html
  • usr/share/doc/qt/qtdoc/obsoleteqmltypes.html
  • usr/share/doc/qt/qtdoc/opensourcelicense.html
  • usr/share/doc/qt/qtdoc/overviews-main.html
  • usr/share/doc/qt/qtdoc/overviews.html
  • usr/share/doc/qt/qtdoc/plugins-howto.html
  • usr/share/doc/qt/qtdoc/porting-to-android.html
  • usr/share/doc/qt/qtdoc/porting-to-ios.html
  • usr/share/doc/qt/qtdoc/portingcppapp.html
  • usr/share/doc/qt/qtdoc/portingguide.html
  • usr/share/doc/qt/qtdoc/portingqmlapp.html
  • usr/share/doc/qt/qtdoc/qml-codingconventions.html
  • usr/share/doc/qt/qtdoc/qml-glossary.html
  • usr/share/doc/qt/qtdoc/qmlapplications.html
  • usr/share/doc/qt/qtdoc/qmlbasictypes.html
  • usr/share/doc/qt/qtdoc/qmlfirststeps.html
  • usr/share/doc/qt/qtdoc/qmltypes.html
  • usr/share/doc/qt/qtdoc/qnx.html
  • usr/share/doc/qt/qtdoc/qpa.html
  • usr/share/doc/qt/qtdoc/qt-activex.html
  • usr/share/doc/qt/qtdoc/qt-attribution-cmake-macros.html
  • usr/share/doc/qt/qtdoc/qt-attribution-llvm.html
  • usr/share/doc/qt/qtdoc/qt-attribution-llvmpipe.html
  • usr/share/doc/qt/qtdoc/qt-conf.html
  • usr/share/doc/qt/qtdoc/qt-embedded-fonts.html
  • usr/share/doc/qt/qtdoc/qt-embedded-kmap2qmap.html
  • usr/share/doc/qt/qtdoc/qt-embedded-makeqpf.html
  • usr/share/doc/qt/qtdoc/qt-gui-concepts.html
  • usr/share/doc/qt/qtdoc/qt5-intro.html
  • usr/share/doc/qt/qtdoc/qtconcurrent-mtexamples.html
  • usr/share/doc/qt/qtdoc/qtconcurrentexamples.html
  • usr/share/doc/qt/qtdoc/qtdoc-attribution-coffeeexample-titillium.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-calqlatr-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-calqlatr-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-calqlatr-qmlproject.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-calqlatr-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-content-button-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-content-calculator-js.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-content-display-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-content-numberpad-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-clocks-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-clocks-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-clocks-qmlproject.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-clocks-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-content-clock-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-applicationflow-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-applicationflowform-ui-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-brewing-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-brewingform-ui-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-choosingcoffee-ui-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-coffee-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-coffeebutton-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-cup-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-cupform-ui-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-emptycup-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-emptycupform-ui-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-imports-coffee-constants-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-imports-coffee-qmldir.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-main-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-navigationbutton-ui-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-qml-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-sidebar-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-sidebarform-ui-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-buildbutton-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-gamecanvas-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-gameoverscreen-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-infobar-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-logic-js.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-mobs-mobbase-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-newgamescreen-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-soundeffect-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-bomb-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-factory-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-melee-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-ranged-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-towerbase-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-maroon-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-maroon-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-maroon-qmlproject.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-maroon-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-photosurface-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-photosurface-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-photosurface-qmlproject.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-photosurface-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-main-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewer-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-albumdelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-busyindicator-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-button-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-editablebutton-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-photodelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-progressbar-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-rssmodel-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-tag-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-busyindicator-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-categorydelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-newsdelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-rssfeeds-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-scrollbar-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-rssnews-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-rssnews-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-rssnews-qmlproject.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-rssnews-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-block-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-blockemitter-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-button-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-gamearea-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level0-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level1-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level2-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level3-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level4-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level5-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level6-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level7-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level8-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level9-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-templatebase-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-logoanimation-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-menuemitter-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-paintemitter-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-primarypack-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-puzzleblock-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-qmldir.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-samegame-js.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-samegametext-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-settings-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-simpleblock-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-smoketext-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-samegame-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-samegame-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-samegame-qmlproject.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-samegame-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-banner-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-button-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-checkbox-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-qmldir.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-settings-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stockchart-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stockinfo-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stocklistdelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stocklistmodel-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stocklistview-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stockmodel-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stocksettingspanel-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stockview-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-windows-settings-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-stocqt-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-stocqt-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-stocqt-qmlproject.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-stocqt-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-flipbar-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-lineinput-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-listfooter-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-listheader-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-searchdelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-tweetdelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-tweetsmodel-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-qmlproject.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-alarmdelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-alarmdialog-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-alarmmodel-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-alarms-pro.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-example.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-main-cpp.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-main-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-qml-qrc.html
  • usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-tumblerdelegate-qml.html
  • usr/share/doc/qt/qtdoc/qtdoc.index
  • usr/share/doc/qt/qtdoc/qtdoc.qhp
  • usr/share/doc/qt/qtdoc/qtdoc.qhp.sha1
  • usr/share/doc/qt/qtdoc/qtexamples.html
  • usr/share/doc/qt/qtdoc/qtexamplesandtutorials.html
  • usr/share/doc/qt/qtdoc/qtmain.html
  • usr/share/doc/qt/qtdoc/qtmodules.html
  • usr/share/doc/qt/qtdoc/qtopenglextensions.html
  • usr/share/doc/qt/qtdoc/qtquick-debugging.html
  • usr/share/doc/qt/qtdoc/qtquick-deployment.html
  • usr/share/doc/qt/qtdoc/qtquick-internationalization.html
  • usr/share/doc/qt/qtdoc/qtquick-performance.html
  • usr/share/doc/qt/qtdoc/qtquick-porting-qt5.html
  • usr/share/doc/qt/qtdoc/qtquick-qmlscene.html
  • usr/share/doc/qt/qtdoc/qtquick-usecase-animations.html
  • usr/share/doc/qt/qtdoc/qtquick-usecase-integratingjs.html
  • usr/share/doc/qt/qtdoc/qtquick-usecase-layouts.html
  • usr/share/doc/qt/qtdoc/qtquick-usecase-styling.html
  • usr/share/doc/qt/qtdoc/qtquick-usecase-text.html
  • usr/share/doc/qt/qtdoc/qtquick-usecase-userinput.html
  • usr/share/doc/qt/qtdoc/qtquick-usecase-visual.html
  • usr/share/doc/qt/qtdoc/qtquickcontrols-texteditor-action.html
  • usr/share/doc/qt/qtdoc/qtquickcontrols-texteditor-logic.html
  • usr/share/doc/qt/qtdoc/qtquickcontrols-texteditor-ui.html
  • usr/share/doc/qt/qtdoc/qtquickcontrols-texteditor.html
  • usr/share/doc/qt/qtdoc/qundo.html
  • usr/share/doc/qt/qtdoc/rcc.html
  • usr/share/doc/qt/qtdoc/reference-overview.html
  • usr/share/doc/qt/qtdoc/restoring-geometry.html
  • usr/share/doc/qt/qtdoc/scalability.html
  • usr/share/doc/qt/qtdoc/session.html
  • usr/share/doc/qt/qtdoc/sharedlibrary.html
  • usr/share/doc/qt/qtdoc/signalsandslots-syntaxes.html
  • usr/share/doc/qt/qtdoc/sourcebreaks.html
  • usr/share/doc/qt/qtdoc/sql-examples.html
  • usr/share/doc/qt/qtdoc/string-processing.html
  • usr/share/doc/qt/qtdoc/style/
  • usr/share/doc/qt/qtdoc/style/offline-simple.css
  • usr/share/doc/qt/qtdoc/style/offline.css
  • usr/share/doc/qt/qtdoc/style/qt5-sidebar.html
  • usr/share/doc/qt/qtdoc/supported-platforms.html
  • usr/share/doc/qt/qtdoc/testing-and-debugging.html
  • usr/share/doc/qt/qtdoc/third-party-libraries.html
  • usr/share/doc/qt/qtdoc/thread-basics.html
  • usr/share/doc/qt/qtdoc/thread.html
  • usr/share/doc/qt/qtdoc/threads-modules.html
  • usr/share/doc/qt/qtdoc/threads-qobject.html
  • usr/share/doc/qt/qtdoc/threads-reentrancy.html
  • usr/share/doc/qt/qtdoc/threads-synchronizing.html
  • usr/share/doc/qt/qtdoc/threads-technologies.html
  • usr/share/doc/qt/qtdoc/threads.html
  • usr/share/doc/qt/qtdoc/topics-app-development.html
  • usr/share/doc/qt/qtdoc/topics-core.html
  • usr/share/doc/qt/qtdoc/topics-data-storage.html
  • usr/share/doc/qt/qtdoc/topics-graphics.html
  • usr/share/doc/qt/qtdoc/topics-network-connectivity.html
  • usr/share/doc/qt/qtdoc/topics-scripting.html
  • usr/share/doc/qt/qtdoc/topics-ui.html
  • usr/share/doc/qt/qtdoc/topics-web-content.html
  • usr/share/doc/qt/qtdoc/touchinputexamples.html
  • usr/share/doc/qt/qtdoc/trademarks.html
  • usr/share/doc/qt/qtdoc/uic.html
  • usr/share/doc/qt/qtdoc/unicode.html
  • usr/share/doc/qt/qtdoc/unix-signals.html
  • usr/share/doc/qt/qtdoc/vxworks.html
  • usr/share/doc/qt/qtdoc/wasm.html
  • usr/share/doc/qt/qtdoc/webgl.html
  • usr/share/doc/qt/qtdoc/whatsnew50.html
  • usr/share/doc/qt/qtdoc/whatsnew51.html
  • usr/share/doc/qt/qtdoc/whatsnew510.html
  • usr/share/doc/qt/qtdoc/whatsnew511.html
  • usr/share/doc/qt/qtdoc/whatsnew512.html
  • usr/share/doc/qt/qtdoc/whatsnew52.html
  • usr/share/doc/qt/qtdoc/whatsnew53.html
  • usr/share/doc/qt/qtdoc/whatsnew54.html
  • usr/share/doc/qt/qtdoc/whatsnew55.html
  • usr/share/doc/qt/qtdoc/whatsnew56.html
  • usr/share/doc/qt/qtdoc/whatsnew57.html
  • usr/share/doc/qt/qtdoc/whatsnew58.html
  • usr/share/doc/qt/qtdoc/whatsnew59.html
  • usr/share/doc/qt/qtdoc/why-moc.html
  • usr/share/doc/qt/qtdoc/windows-building.html
  • usr/share/doc/qt/qtdoc/windows-deployment.html
  • usr/share/doc/qt/qtdoc/windows-issues.html
  • usr/share/doc/qt/qtdoc/windows-requirements.html
  • usr/share/doc/qt/qtdoc/windows.html
  • usr/share/doc/qt/qtdoc/winrt-support.html
  • usr/share/doc/qt/qtdoc/xml-examples.html
  • usr/share/doc/qt/qtgamepad.qch
  • usr/share/doc/qt/qtgamepad/
  • usr/share/doc/qt/qtgamepad/examples-manifest.xml
  • usr/share/doc/qt/qtgamepad/images/
  • usr/share/doc/qt/qtgamepad/images/arrow_bc.png
  • usr/share/doc/qt/qtgamepad/images/bgrContent.png
  • usr/share/doc/qt/qtgamepad/images/btn_next.png
  • usr/share/doc/qt/qtgamepad/images/btn_prev.png
  • usr/share/doc/qt/qtgamepad/images/bullet_dn.png
  • usr/share/doc/qt/qtgamepad/images/bullet_sq.png
  • usr/share/doc/qt/qtgamepad/images/configuregamepadbuttons-example.png
  • usr/share/doc/qt/qtgamepad/images/home.png
  • usr/share/doc/qt/qtgamepad/images/ico_note.png
  • usr/share/doc/qt/qtgamepad/images/ico_note_attention.png
  • usr/share/doc/qt/qtgamepad/images/ico_out.png
  • usr/share/doc/qt/qtgamepad/images/keynavigationgamepad-example.png
  • usr/share/doc/qt/qtgamepad/images/logo.png
  • usr/share/doc/qt/qtgamepad/images/qtquickgamepad-example.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/keyNavigation/
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/keyNavigation/keyNavigation64.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/keyNavigation/keyNavigation80.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/mouseItem/
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/mouseItem/mouseItem64.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/mouseItem/mouseItem80.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerBack.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonA.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonB.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonGuide.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonX.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonY.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerDPad.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftShoulder.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftThumbstick.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftTrigger.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightShoulder.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightThumbstick.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightTrigger.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerStart.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/quickGamepad64.png
  • usr/share/doc/qt/qtgamepad/images/used-in-examples/quickGamepad/quickGamepad80.png
  • usr/share/doc/qt/qtgamepad/qgamepad-members.html
  • usr/share/doc/qt/qtgamepad/qgamepad-obsolete.html
  • usr/share/doc/qt/qtgamepad/qgamepad.html
  • usr/share/doc/qt/qtgamepad/qgamepadkeynavigation-members.html
  • usr/share/doc/qt/qtgamepad/qgamepadkeynavigation-obsolete.html
  • usr/share/doc/qt/qtgamepad/qgamepadkeynavigation.html
  • usr/share/doc/qt/qtgamepad/qgamepadmanager-members.html
  • usr/share/doc/qt/qtgamepad/qgamepadmanager-obsolete.html
  • usr/share/doc/qt/qtgamepad/qgamepadmanager.html
  • usr/share/doc/qt/qtgamepad/qml-qtgamepad-gamepad-members.html
  • usr/share/doc/qt/qtgamepad/qml-qtgamepad-gamepad.html
  • usr/share/doc/qt/qtgamepad/qml-qtgamepad-gamepadmanager-members.html
  • usr/share/doc/qt/qtgamepad/qml-qtgamepad-gamepadmanager.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-configurebuttons-android-androidmanifest-xml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-configurebuttons-configurebuttons-pro.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-configurebuttons-example.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-configurebuttons-main-cpp.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-configurebuttons-main-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-configurebuttons-qml-qrc.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-examples.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-index.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-keynavigation-example.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-keynavigation-keynavigation-pro.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-keynavigation-main-cpp.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-keynavigation-qml-main-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-keynavigation-qml-qrc.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-module.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-mouseitem-example.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-mouseitem-main-cpp.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-mouseitem-mouseitem-pro.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-mouseitem-qml-main-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-mouseitem-qml-qrc.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-qmlmodule.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-example.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-main-cpp.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-qml-buttonimage-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-qml-dpad-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-qml-joystickviewer-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-qml-leftthumbstick-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-qml-main-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-qml-qrc.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-qml-rightthumbstick-qml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-quickgamepad-pro.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-simple-android-androidmanifest-xml.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-simple-example.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-simple-gamepadmonitor-cpp.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-simple-gamepadmonitor-h.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-simple-main-cpp.html
  • usr/share/doc/qt/qtgamepad/qtgamepad-simple-simple-pro.html
  • usr/share/doc/qt/qtgamepad/qtgamepad.index
  • usr/share/doc/qt/qtgamepad/qtgamepad.qhp
  • usr/share/doc/qt/qtgamepad/qtgamepad.qhp.sha1
  • usr/share/doc/qt/qtgamepad/style/
  • usr/share/doc/qt/qtgamepad/style/offline-simple.css
  • usr/share/doc/qt/qtgamepad/style/offline.css
  • usr/share/doc/qt/qtgraphicaleffects.qch
  • usr/share/doc/qt/qtgraphicaleffects/
  • usr/share/doc/qt/qtgraphicaleffects/graphicaleffects.html
  • usr/share/doc/qt/qtgraphicaleffects/images/
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_bug_and_butterfly.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode10.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode11.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode12.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode13.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode14.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode15.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode16.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode17.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode18.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode19.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode20.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode21.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode22.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode4.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode5.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode6.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode7.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode8.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode9.png
  • usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_brightness1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_brightness2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_brightness3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_contrast1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_contrast2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_contrast3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_contrast_graph.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ColorOverlay_butterfly.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ColorOverlay_color1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ColorOverlay_color2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ColorOverlay_color3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_hue1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_hue2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_hue3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_hue_scale.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_lightness1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_lightness2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_lightness3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_saturation1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_saturation2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Colorize_saturation3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_angle1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_angle2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_angle3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_gradient1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_gradient2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_gradient3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_horizontalOffset1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_horizontalOffset2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_horizontalOffset3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_maskSource1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_maskSource2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Desaturate_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Desaturate_desaturation1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Desaturate_desaturation2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Desaturate_desaturation3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_angle1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_angle2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_angle3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_length1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_length2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_length3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Displace_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Displace_displacement1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Displace_displacement2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Displace_displacement3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Displace_map.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow-transparentBorder.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_butterfly.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_color1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_color2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_color3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_horizontalOffset1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_horizontalOffset2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_horizontalOffset3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_radius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_radius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_radius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_spread1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_spread2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_spread3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_radius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_radius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_radius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_transparentBorder1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_transparentBorder2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma1_graph.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma2_graph.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma3_graph.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_deviation1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_deviation2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_deviation3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_deviation_graph.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_radius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_radius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_radius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_transparentBorder1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_transparentBorder2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow-transparentBorder.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_butterfly.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_color1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_color2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_color3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_radius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_radius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_radius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_spread1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_spread2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Glow_spread3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_hue1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_hue2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_hue3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_lightness1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_lightness2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_lightness3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_saturation1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_saturation2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_saturation3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_butterfly.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_color1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_color2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_color3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_fast1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_fast2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_horizontalOffset1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_horizontalOffset2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_horizontalOffset3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_radius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_radius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_radius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_spread1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_spread2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_spread3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_butterfly.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_default_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma2_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma3_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput2_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput3_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput2_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput3_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput2_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput3_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput2_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput3_curve.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_end1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_end2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_end3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_gradient1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_gradient2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_gradient3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_maskSource1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_maskSource2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_start1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_start2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_start3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_mask.png
  • usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_radius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_radius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_radius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/OpacityMask_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/OpacityMask_mask.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Original_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Original_butterfly.png
  • usr/share/doc/qt/qtgraphicaleffects/images/Original_butterfly_black.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_angle1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_angle2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_angle3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_horizontalOffset1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_horizontalOffset2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_horizontalOffset3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_angle1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_angle2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_angle3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_gradient1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_gradient2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_gradient3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalOffset1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalOffset2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalOffset3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalRadius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalRadius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_maskSource1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_maskSource2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_applied.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_color1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_color2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_color3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_cornerRadius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_cornerRadius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_cornerRadius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_glowRadius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_glowRadius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_glowRadius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_spread1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_spread2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_spread3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_loops1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_loops2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_loops3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_radius1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_radius2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_radius3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_transparentBorder1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_transparentBorder2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_mask.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_spread1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_spread2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_spread3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_threshold1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_threshold2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_threshold3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_bug.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_horizontalOffset1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_horizontalOffset2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_horizontalOffset3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_length1.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_length2.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_length3.png
  • usr/share/doc/qt/qtgraphicaleffects/images/arrow_bc.png
  • usr/share/doc/qt/qtgraphicaleffects/images/bgrContent.png
  • usr/share/doc/qt/qtgraphicaleffects/images/btn_next.png
  • usr/share/doc/qt/qtgraphicaleffects/images/btn_prev.png
  • usr/share/doc/qt/qtgraphicaleffects/images/bullet_dn.png
  • usr/share/doc/qt/qtgraphicaleffects/images/bullet_sq.png
  • usr/share/doc/qt/qtgraphicaleffects/images/home.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ico_note.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ico_note_attention.png
  • usr/share/doc/qt/qtgraphicaleffects/images/ico_out.png
  • usr/share/doc/qt/qtgraphicaleffects/images/logo.png
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-blend-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-blend.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-colorize-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-colorize.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-displace-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-displace.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-glow-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-glow.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur-members.html
  • usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur.html
  • usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects-index.html
  • usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects-qmlmodule.html
  • usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects.index
  • usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects.qhp
  • usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects.qhp.sha1
  • usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects.tags
  • usr/share/doc/qt/qtgraphicaleffects/style/
  • usr/share/doc/qt/qtgraphicaleffects/style/offline-simple.css
  • usr/share/doc/qt/qtgraphicaleffects/style/offline.css
  • usr/share/doc/qt/qtgui.qch
  • usr/share/doc/qt/qtgui/
  • usr/share/doc/qt/qtgui/coordsys.html
  • usr/share/doc/qt/qtgui/dnd.html
  • usr/share/doc/qt/qtgui/examples-manifest.xml
  • usr/share/doc/qt/qtgui/images/
  • usr/share/doc/qt/qtgui/images/alphafill.png
  • usr/share/doc/qt/qtgui/images/analogclock-window-example.png
  • usr/share/doc/qt/qtgui/images/analogclockwindow-viewport.png
  • usr/share/doc/qt/qtgui/images/arrow_bc.png
  • usr/share/doc/qt/qtgui/images/bearings.png
  • usr/share/doc/qt/qtgui/images/bgrContent.png
  • usr/share/doc/qt/qtgui/images/brush-outline.png
  • usr/share/doc/qt/qtgui/images/brush-styles.png
  • usr/share/doc/qt/qtgui/images/btn_next.png
  • usr/share/doc/qt/qtgui/images/btn_prev.png
  • usr/share/doc/qt/qtgui/images/bullet_dn.png
  • usr/share/doc/qt/qtgui/images/bullet_sq.png
  • usr/share/doc/qt/qtgui/images/coordinatesystem-analogclock.png
  • usr/share/doc/qt/qtgui/images/coordinatesystem-line-antialias.png
  • usr/share/doc/qt/qtgui/images/coordinatesystem-line-raster.png
  • usr/share/doc/qt/qtgui/images/coordinatesystem-line.png
  • usr/share/doc/qt/qtgui/images/coordinatesystem-rect-antialias.png
  • usr/share/doc/qt/qtgui/images/coordinatesystem-rect-raster.png
  • usr/share/doc/qt/qtgui/images/coordinatesystem-rect.png
  • usr/share/doc/qt/qtgui/images/coordinatesystem-transformations.png
  • usr/share/doc/qt/qtgui/images/cursor-arrow.png
  • usr/share/doc/qt/qtgui/images/cursor-busy.png
  • usr/share/doc/qt/qtgui/images/cursor-closedhand.png
  • usr/share/doc/qt/qtgui/images/cursor-cross.png
  • usr/share/doc/qt/qtgui/images/cursor-forbidden.png
  • usr/share/doc/qt/qtgui/images/cursor-hand.png
  • usr/share/doc/qt/qtgui/images/cursor-hsplit.png
  • usr/share/doc/qt/qtgui/images/cursor-ibeam.png
  • usr/share/doc/qt/qtgui/images/cursor-openhand.png
  • usr/share/doc/qt/qtgui/images/cursor-sizeall.png
  • usr/share/doc/qt/qtgui/images/cursor-sizeb.png
  • usr/share/doc/qt/qtgui/images/cursor-sizef.png
  • usr/share/doc/qt/qtgui/images/cursor-sizeh.png
  • usr/share/doc/qt/qtgui/images/cursor-sizev.png
  • usr/share/doc/qt/qtgui/images/cursor-uparrow.png
  • usr/share/doc/qt/qtgui/images/cursor-vsplit.png
  • usr/share/doc/qt/qtgui/images/cursor-wait.png
  • usr/share/doc/qt/qtgui/images/cursor-whatsthis.png
  • usr/share/doc/qt/qtgui/images/hellovulkancubes.png
  • usr/share/doc/qt/qtgui/images/hellovulkantexture.png
  • usr/share/doc/qt/qtgui/images/hellovulkantriangle.png
  • usr/share/doc/qt/qtgui/images/hellovulkanwidget.png
  • usr/share/doc/qt/qtgui/images/hellovulkanwindow.png
  • usr/share/doc/qt/qtgui/images/home.png
  • usr/share/doc/qt/qtgui/images/hoverevents.png
  • usr/share/doc/qt/qtgui/images/ico_note.png
  • usr/share/doc/qt/qtgui/images/ico_note_attention.png
  • usr/share/doc/qt/qtgui/images/ico_out.png
  • usr/share/doc/qt/qtgui/images/icon.png
  • usr/share/doc/qt/qtgui/images/logo.png
  • usr/share/doc/qt/qtgui/images/openglwindow-example.png
  • usr/share/doc/qt/qtgui/images/paintsystem-antialiasing.png
  • usr/share/doc/qt/qtgui/images/paintsystem-core.png
  • usr/share/doc/qt/qtgui/images/paintsystem-fancygradient.png
  • usr/share/doc/qt/qtgui/images/paintsystem-gradients.png
  • usr/share/doc/qt/qtgui/images/paintsystem-movie.png
  • usr/share/doc/qt/qtgui/images/paintsystem-painterpath.png
  • usr/share/doc/qt/qtgui/images/palette.png
  • usr/share/doc/qt/qtgui/images/plaintext-layout.png
  • usr/share/doc/qt/qtgui/images/qcolor-cmyk.png
  • usr/share/doc/qt/qtgui/images/qcolor-hsv.png
  • usr/share/doc/qt/qtgui/images/qcolor-hue.png
  • usr/share/doc/qt/qtgui/images/qcolor-rgb.png
  • usr/share/doc/qt/qtgui/images/qcolor-saturation.png
  • usr/share/doc/qt/qtgui/images/qcolor-value.png
  • usr/share/doc/qt/qtgui/images/qconicalgradient.png
  • usr/share/doc/qt/qtgui/images/qgradient-conical.png
  • usr/share/doc/qt/qtgui/images/qgradient-linear.png
  • usr/share/doc/qt/qtgui/images/qgradient-radial.png
  • usr/share/doc/qt/qtgui/images/qimage-32bit_scaled.png
  • usr/share/doc/qt/qtgui/images/qimage-8bit_scaled.png
  • usr/share/doc/qt/qtgui/images/qlineargradient-pad.png
  • usr/share/doc/qt/qtgui/images/qlineargradient-reflect.png
  • usr/share/doc/qt/qtgui/images/qlineargradient-repeat.png
  • usr/share/doc/qt/qtgui/images/qmatrix-combinedtransformation.png
  • usr/share/doc/qt/qtgui/images/qmatrix-representation.png
  • usr/share/doc/qt/qtgui/images/qmatrix-simpletransformation.png
  • usr/share/doc/qt/qtgui/images/qpainter-affinetransformations.png
  • usr/share/doc/qt/qtgui/images/qpainter-basicdrawing.png
  • usr/share/doc/qt/qtgui/images/qpainter-clock.png
  • usr/share/doc/qt/qtgui/images/qpainter-compositiondemo.png
  • usr/share/doc/qt/qtgui/images/qpainter-compositionmode1.png
  • usr/share/doc/qt/qtgui/images/qpainter-compositionmode2.png
  • usr/share/doc/qt/qtgui/images/qpainter-concentriccircles.png
  • usr/share/doc/qt/qtgui/images/qpainter-gradients.png
  • usr/share/doc/qt/qtgui/images/qpainter-painterpaths.png
  • usr/share/doc/qt/qtgui/images/qpainter-path.png
  • usr/share/doc/qt/qtgui/images/qpainter-pathstroking.png
  • usr/share/doc/qt/qtgui/images/qpainter-polygon.png
  • usr/share/doc/qt/qtgui/images/qpainter-rotation.png
  • usr/share/doc/qt/qtgui/images/qpainter-roundrect.png
  • usr/share/doc/qt/qtgui/images/qpainter-scale.png
  • usr/share/doc/qt/qtgui/images/qpainter-translation.png
  • usr/share/doc/qt/qtgui/images/qpainter-vectordeformation.png
  • usr/share/doc/qt/qtgui/images/qpainterpath-addpolygon.png
  • usr/share/doc/qt/qtgui/images/qpainterpath-construction.png
  • usr/share/doc/qt/qtgui/images/qpainterpath-demo.png
  • usr/share/doc/qt/qtgui/images/qpainterpath-example.png
  • usr/share/doc/qt/qtgui/images/qpen-bevel.png
  • usr/share/doc/qt/qtgui/images/qpen-custom.png
  • usr/share/doc/qt/qtgui/images/qpen-dash.png
  • usr/share/doc/qt/qtgui/images/qpen-dashdot.png
  • usr/share/doc/qt/qtgui/images/qpen-dashdotdot.png
  • usr/share/doc/qt/qtgui/images/qpen-dashpattern.png
  • usr/share/doc/qt/qtgui/images/qpen-demo.png
  • usr/share/doc/qt/qtgui/images/qpen-dot.png
  • usr/share/doc/qt/qtgui/images/qpen-flat.png
  • usr/share/doc/qt/qtgui/images/qpen-miter.png
  • usr/share/doc/qt/qtgui/images/qpen-miterlimit.png
  • usr/share/doc/qt/qtgui/images/qpen-roundcap.png
  • usr/share/doc/qt/qtgui/images/qpen-roundjoin.png
  • usr/share/doc/qt/qtgui/images/qpen-solid.png
  • usr/share/doc/qt/qtgui/images/qpen-square.png
  • usr/share/doc/qt/qtgui/images/qpixelformat-argb32buffer.png
  • usr/share/doc/qt/qtgui/images/qradialgradient-pad.png
  • usr/share/doc/qt/qtgui/images/qradialgradient-reflect.png
  • usr/share/doc/qt/qtgui/images/qradialgradient-repeat.png
  • usr/share/doc/qt/qtgui/images/qrect-diagram-zero.png
  • usr/share/doc/qt/qtgui/images/qrectf-diagram-one.png
  • usr/share/doc/qt/qtgui/images/qrectf-diagram-three.png
  • usr/share/doc/qt/qtgui/images/qrectf-diagram-two.png
  • usr/share/doc/qt/qtgui/images/qstatustipevent-action.png
  • usr/share/doc/qt/qtgui/images/qstatustipevent-widget.png
  • usr/share/doc/qt/qtgui/images/qt-colors.png
  • usr/share/doc/qt/qtgui/images/qt-fillrule-oddeven.png
  • usr/share/doc/qt/qtgui/images/qt-fillrule-winding.png
  • usr/share/doc/qt/qtgui/images/qtextblock-sequence.png
  • usr/share/doc/qt/qtgui/images/qtextfragment-split.png
  • usr/share/doc/qt/qtgui/images/qtextframe-style.png
  • usr/share/doc/qt/qtgui/images/qtexttableformat-cell.png
  • usr/share/doc/qt/qtgui/images/qtransform-combinedtransformation.png
  • usr/share/doc/qt/qtgui/images/qtransform-combinedtransformation2.png
  • usr/share/doc/qt/qtgui/images/qtransform-representation.png
  • usr/share/doc/qt/qtgui/images/qtransform-simpletransformation.png
  • usr/share/doc/qt/qtgui/images/richtext-document.png
  • usr/share/doc/qt/qtgui/images/texttable-merge.png
  • usr/share/doc/qt/qtgui/images/texttable-split.png
  • usr/share/doc/qt/qtgui/images/touchpoint-metrics.png
  • usr/share/doc/qt/qtgui/images/used-in-examples/
  • usr/share/doc/qt/qtgui/images/used-in-examples/hellovulkantexture/
  • usr/share/doc/qt/qtgui/images/used-in-examples/hellovulkantexture/qt256.png
  • usr/share/doc/qt/qtgui/painting-3d.html
  • usr/share/doc/qt/qtgui/painting.html
  • usr/share/doc/qt/qtgui/paintsystem-devices.html
  • usr/share/doc/qt/qtgui/paintsystem-drawing.html
  • usr/share/doc/qt/qtgui/paintsystem-images.html
  • usr/share/doc/qt/qtgui/paintsystem.html
  • usr/share/doc/qt/qtgui/qabstractopenglfunctions-members.html
  • usr/share/doc/qt/qtgui/qabstractopenglfunctions.html
  • usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-members.html
  • usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-obsolete.html
  • usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-paintcontext-members.html
  • usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-paintcontext.html
  • usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-selection-members.html
  • usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-selection.html
  • usr/share/doc/qt/qtgui/qabstracttextdocumentlayout.html
  • usr/share/doc/qt/qtgui/qaccessible-members.html
  • usr/share/doc/qt/qtgui/qaccessible-state-members.html
  • usr/share/doc/qt/qtgui/qaccessible-state.html
  • usr/share/doc/qt/qtgui/qaccessible.html
  • usr/share/doc/qt/qtgui/qaccessibleactioninterface-members.html
  • usr/share/doc/qt/qtgui/qaccessibleactioninterface.html
  • usr/share/doc/qt/qtgui/qaccessibleeditabletextinterface-members.html
  • usr/share/doc/qt/qtgui/qaccessibleeditabletextinterface.html
  • usr/share/doc/qt/qtgui/qaccessibleevent-members.html
  • usr/share/doc/qt/qtgui/qaccessibleevent.html
  • usr/share/doc/qt/qtgui/qaccessibleinterface-members.html
  • usr/share/doc/qt/qtgui/qaccessibleinterface.html
  • usr/share/doc/qt/qtgui/qaccessibleobject-members.html
  • usr/share/doc/qt/qtgui/qaccessibleobject.html
  • usr/share/doc/qt/qtgui/qaccessibleplugin-members.html
  • usr/share/doc/qt/qtgui/qaccessibleplugin-obsolete.html
  • usr/share/doc/qt/qtgui/qaccessibleplugin.html
  • usr/share/doc/qt/qtgui/qaccessiblestatechangeevent-members.html
  • usr/share/doc/qt/qtgui/qaccessiblestatechangeevent.html
  • usr/share/doc/qt/qtgui/qaccessibletablecellinterface-members.html
  • usr/share/doc/qt/qtgui/qaccessibletablecellinterface.html
  • usr/share/doc/qt/qtgui/qaccessibletableinterface-members.html
  • usr/share/doc/qt/qtgui/qaccessibletableinterface.html
  • usr/share/doc/qt/qtgui/qaccessibletablemodelchangeevent-members.html
  • usr/share/doc/qt/qtgui/qaccessibletablemodelchangeevent.html
  • usr/share/doc/qt/qtgui/qaccessibletextcursorevent-members.html
  • usr/share/doc/qt/qtgui/qaccessibletextcursorevent.html
  • usr/share/doc/qt/qtgui/qaccessibletextinsertevent-members.html
  • usr/share/doc/qt/qtgui/qaccessibletextinsertevent.html
  • usr/share/doc/qt/qtgui/qaccessibletextinterface-members.html
  • usr/share/doc/qt/qtgui/qaccessibletextinterface.html
  • usr/share/doc/qt/qtgui/qaccessibletextremoveevent-members.html
  • usr/share/doc/qt/qtgui/qaccessibletextremoveevent.html
  • usr/share/doc/qt/qtgui/qaccessibletextselectionevent-members.html
  • usr/share/doc/qt/qtgui/qaccessibletextselectionevent.html
  • usr/share/doc/qt/qtgui/qaccessibletextupdateevent-members.html
  • usr/share/doc/qt/qtgui/qaccessibletextupdateevent.html
  • usr/share/doc/qt/qtgui/qaccessiblevaluechangeevent-members.html
  • usr/share/doc/qt/qtgui/qaccessiblevaluechangeevent.html
  • usr/share/doc/qt/qtgui/qaccessiblevalueinterface-members.html
  • usr/share/doc/qt/qtgui/qaccessiblevalueinterface.html
  • usr/share/doc/qt/qtgui/qactionevent-members.html
  • usr/share/doc/qt/qtgui/qactionevent.html
  • usr/share/doc/qt/qtgui/qbackingstore-members.html
  • usr/share/doc/qt/qtgui/qbackingstore.html
  • usr/share/doc/qt/qtgui/qbitmap-members.html
  • usr/share/doc/qt/qtgui/qbitmap-obsolete.html
  • usr/share/doc/qt/qtgui/qbitmap.html
  • usr/share/doc/qt/qtgui/qbrush-members.html
  • usr/share/doc/qt/qtgui/qbrush.html
  • usr/share/doc/qt/qtgui/qclipboard-members.html
  • usr/share/doc/qt/qtgui/qclipboard-obsolete.html
  • usr/share/doc/qt/qtgui/qclipboard.html
  • usr/share/doc/qt/qtgui/qcloseevent-members.html
  • usr/share/doc/qt/qtgui/qcloseevent.html
  • usr/share/doc/qt/qtgui/qcolor-members.html
  • usr/share/doc/qt/qtgui/qcolor-obsolete.html
  • usr/share/doc/qt/qtgui/qcolor.html
  • usr/share/doc/qt/qtgui/qconicalgradient-members.html
  • usr/share/doc/qt/qtgui/qconicalgradient.html
  • usr/share/doc/qt/qtgui/qcontextmenuevent-members.html
  • usr/share/doc/qt/qtgui/qcontextmenuevent.html
  • usr/share/doc/qt/qtgui/qcursor-members.html
  • usr/share/doc/qt/qtgui/qcursor.html
  • usr/share/doc/qt/qtgui/qdesktopservices-members.html
  • usr/share/doc/qt/qtgui/qdesktopservices.html
  • usr/share/doc/qt/qtgui/qdoublevalidator-members.html
  • usr/share/doc/qt/qtgui/qdoublevalidator-obsolete.html
  • usr/share/doc/qt/qtgui/qdoublevalidator.html
  • usr/share/doc/qt/qtgui/qdrag-members.html
  • usr/share/doc/qt/qtgui/qdrag-obsolete.html
  • usr/share/doc/qt/qtgui/qdrag.html
  • usr/share/doc/qt/qtgui/qdragenterevent-members.html
  • usr/share/doc/qt/qtgui/qdragenterevent.html
  • usr/share/doc/qt/qtgui/qdragleaveevent-members.html
  • usr/share/doc/qt/qtgui/qdragleaveevent.html
  • usr/share/doc/qt/qtgui/qdragmoveevent-members.html
  • usr/share/doc/qt/qtgui/qdragmoveevent.html
  • usr/share/doc/qt/qtgui/qdropevent-members.html
  • usr/share/doc/qt/qtgui/qdropevent.html
  • usr/share/doc/qt/qtgui/qenterevent-members.html
  • usr/share/doc/qt/qtgui/qenterevent.html
  • usr/share/doc/qt/qtgui/qexposeevent-members.html
  • usr/share/doc/qt/qtgui/qexposeevent.html
  • usr/share/doc/qt/qtgui/qfileopenevent-members.html
  • usr/share/doc/qt/qtgui/qfileopenevent.html
  • usr/share/doc/qt/qtgui/qfocusevent-members.html
  • usr/share/doc/qt/qtgui/qfocusevent.html
  • usr/share/doc/qt/qtgui/qfont-members.html
  • usr/share/doc/qt/qtgui/qfont-obsolete.html
  • usr/share/doc/qt/qtgui/qfont.html
  • usr/share/doc/qt/qtgui/qfontdatabase-members.html
  • usr/share/doc/qt/qtgui/qfontdatabase.html
  • usr/share/doc/qt/qtgui/qfontinfo-members.html
  • usr/share/doc/qt/qtgui/qfontinfo-obsolete.html
  • usr/share/doc/qt/qtgui/qfontinfo.html
  • usr/share/doc/qt/qtgui/qfontmetrics-members.html
  • usr/share/doc/qt/qtgui/qfontmetrics-obsolete.html
  • usr/share/doc/qt/qtgui/qfontmetrics.html
  • usr/share/doc/qt/qtgui/qfontmetricsf-members.html
  • usr/share/doc/qt/qtgui/qfontmetricsf-obsolete.html
  • usr/share/doc/qt/qtgui/qfontmetricsf.html
  • usr/share/doc/qt/qtgui/qgenericmatrix-members.html
  • usr/share/doc/qt/qtgui/qgenericmatrix.html
  • usr/share/doc/qt/qtgui/qgenericplugin-members.html
  • usr/share/doc/qt/qtgui/qgenericplugin-obsolete.html
  • usr/share/doc/qt/qtgui/qgenericplugin.html
  • usr/share/doc/qt/qtgui/qgenericpluginfactory-members.html
  • usr/share/doc/qt/qtgui/qgenericpluginfactory.html
  • usr/share/doc/qt/qtgui/qglyphrun-members.html
  • usr/share/doc/qt/qtgui/qglyphrun.html
  • usr/share/doc/qt/qtgui/qgradient-members.html
  • usr/share/doc/qt/qtgui/qgradient.html
  • usr/share/doc/qt/qtgui/qguiapplication-members.html
  • usr/share/doc/qt/qtgui/qguiapplication-obsolete.html
  • usr/share/doc/qt/qtgui/qguiapplication.html
  • usr/share/doc/qt/qtgui/qhelpevent-members.html
  • usr/share/doc/qt/qtgui/qhelpevent.html
  • usr/share/doc/qt/qtgui/qhideevent-members.html
  • usr/share/doc/qt/qtgui/qhideevent.html
  • usr/share/doc/qt/qtgui/qhoverevent-members.html
  • usr/share/doc/qt/qtgui/qhoverevent.html
  • usr/share/doc/qt/qtgui/qicon-members.html
  • usr/share/doc/qt/qtgui/qicon.html
  • usr/share/doc/qt/qtgui/qicondragevent-members.html
  • usr/share/doc/qt/qtgui/qicondragevent.html
  • usr/share/doc/qt/qtgui/qiconengine-availablesizesargument-members.html
  • usr/share/doc/qt/qtgui/qiconengine-availablesizesargument.html
  • usr/share/doc/qt/qtgui/qiconengine-members.html
  • usr/share/doc/qt/qtgui/qiconengine-scaledpixmapargument-members.html
  • usr/share/doc/qt/qtgui/qiconengine-scaledpixmapargument.html
  • usr/share/doc/qt/qtgui/qiconengine.html
  • usr/share/doc/qt/qtgui/qiconengineplugin-members.html
  • usr/share/doc/qt/qtgui/qiconengineplugin-obsolete.html
  • usr/share/doc/qt/qtgui/qiconengineplugin.html
  • usr/share/doc/qt/qtgui/qimage-members.html
  • usr/share/doc/qt/qtgui/qimage-obsolete.html
  • usr/share/doc/qt/qtgui/qimage.html
  • usr/share/doc/qt/qtgui/qimageiohandler-members.html
  • usr/share/doc/qt/qtgui/qimageiohandler-obsolete.html
  • usr/share/doc/qt/qtgui/qimageiohandler.html
  • usr/share/doc/qt/qtgui/qimageioplugin-members.html
  • usr/share/doc/qt/qtgui/qimageioplugin-obsolete.html
  • usr/share/doc/qt/qtgui/qimageioplugin.html
  • usr/share/doc/qt/qtgui/qimagereader-members.html
  • usr/share/doc/qt/qtgui/qimagereader.html
  • usr/share/doc/qt/qtgui/qimagewriter-members.html
  • usr/share/doc/qt/qtgui/qimagewriter-obsolete.html
  • usr/share/doc/qt/qtgui/qimagewriter.html
  • usr/share/doc/qt/qtgui/qinputevent-members.html
  • usr/share/doc/qt/qtgui/qinputevent.html
  • usr/share/doc/qt/qtgui/qinputmethod-members.html
  • usr/share/doc/qt/qtgui/qinputmethod-obsolete.html
  • usr/share/doc/qt/qtgui/qinputmethod.html
  • usr/share/doc/qt/qtgui/qinputmethodevent-attribute-members.html
  • usr/share/doc/qt/qtgui/qinputmethodevent-attribute.html
  • usr/share/doc/qt/qtgui/qinputmethodevent-members.html
  • usr/share/doc/qt/qtgui/qinputmethodevent.html
  • usr/share/doc/qt/qtgui/qinputmethodqueryevent-members.html
  • usr/share/doc/qt/qtgui/qinputmethodqueryevent.html
  • usr/share/doc/qt/qtgui/qintvalidator-members.html
  • usr/share/doc/qt/qtgui/qintvalidator-obsolete.html
  • usr/share/doc/qt/qtgui/qintvalidator.html
  • usr/share/doc/qt/qtgui/qkeyevent-members.html
  • usr/share/doc/qt/qtgui/qkeyevent.html
  • usr/share/doc/qt/qtgui/qkeysequence-members.html
  • usr/share/doc/qt/qtgui/qkeysequence.html
  • usr/share/doc/qt/qtgui/qlineargradient-members.html
  • usr/share/doc/qt/qtgui/qlineargradient.html
  • usr/share/doc/qt/qtgui/qmatrix-members.html
  • usr/share/doc/qt/qtgui/qmatrix.html
  • usr/share/doc/qt/qtgui/qmatrix4x4-members.html
  • usr/share/doc/qt/qtgui/qmatrix4x4-obsolete.html
  • usr/share/doc/qt/qtgui/qmatrix4x4.html
  • usr/share/doc/qt/qtgui/qmouseevent-members.html
  • usr/share/doc/qt/qtgui/qmouseevent.html
  • usr/share/doc/qt/qtgui/qmoveevent-members.html
  • usr/share/doc/qt/qtgui/qmoveevent.html
  • usr/share/doc/qt/qtgui/qmovie-members.html
  • usr/share/doc/qt/qtgui/qmovie-obsolete.html
  • usr/share/doc/qt/qtgui/qmovie.html
  • usr/share/doc/qt/qtgui/qnativegestureevent-members.html
  • usr/share/doc/qt/qtgui/qnativegestureevent-obsolete.html
  • usr/share/doc/qt/qtgui/qnativegestureevent.html
  • usr/share/doc/qt/qtgui/qoffscreensurface-members.html
  • usr/share/doc/qt/qtgui/qoffscreensurface-obsolete.html
  • usr/share/doc/qt/qtgui/qoffscreensurface.html
  • usr/share/doc/qt/qtgui/qopenglbuffer-members.html
  • usr/share/doc/qt/qtgui/qopenglbuffer.html
  • usr/share/doc/qt/qtgui/qopenglcontext-members.html
  • usr/share/doc/qt/qtgui/qopenglcontext-obsolete.html
  • usr/share/doc/qt/qtgui/qopenglcontext.html
  • usr/share/doc/qt/qtgui/qopenglcontextgroup-members.html
  • usr/share/doc/qt/qtgui/qopenglcontextgroup-obsolete.html
  • usr/share/doc/qt/qtgui/qopenglcontextgroup.html
  • usr/share/doc/qt/qtgui/qopengldebuglogger-members.html
  • usr/share/doc/qt/qtgui/qopengldebuglogger-obsolete.html
  • usr/share/doc/qt/qtgui/qopengldebuglogger.html
  • usr/share/doc/qt/qtgui/qopengldebugmessage-members.html
  • usr/share/doc/qt/qtgui/qopengldebugmessage.html
  • usr/share/doc/qt/qtgui/qopenglextrafunctions-members.html
  • usr/share/doc/qt/qtgui/qopenglextrafunctions.html
  • usr/share/doc/qt/qtgui/qopenglframebufferobject-members.html
  • usr/share/doc/qt/qtgui/qopenglframebufferobject.html
  • usr/share/doc/qt/qtgui/qopenglframebufferobjectformat-members.html
  • usr/share/doc/qt/qtgui/qopenglframebufferobjectformat.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-0-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-0.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-1-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-1.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-2-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-2.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-3-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-3.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-4-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-4.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-5-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-1-5.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-2-0-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-2-0.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-2-1-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-2-1.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-0-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-0.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-1-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-1.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-2-compatibility-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-2-compatibility.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-2-core-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-2-core.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-3-compatibility-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-3-compatibility.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-3-core-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-3-3-core.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-0-compatibility-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-0-compatibility.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-0-core-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-0-core.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-1-compatibility-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-1-compatibility.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-1-core-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-1-core.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-2-compatibility-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-2-compatibility.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-2-core-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-2-core.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-3-compatibility-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-3-compatibility.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-3-core-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-3-core.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-4-compatibility-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-4-compatibility.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-4-core-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-4-core.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-5-compatibility-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-5-compatibility.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-5-core-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-4-5-core.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-es2-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-es2.html
  • usr/share/doc/qt/qtgui/qopenglfunctions-members.html
  • usr/share/doc/qt/qtgui/qopenglfunctions.html
  • usr/share/doc/qt/qtgui/qopenglpaintdevice-members.html
  • usr/share/doc/qt/qtgui/qopenglpaintdevice.html
  • usr/share/doc/qt/qtgui/qopenglpixeltransferoptions-members.html
  • usr/share/doc/qt/qtgui/qopenglpixeltransferoptions.html
  • usr/share/doc/qt/qtgui/qopenglshader-members.html
  • usr/share/doc/qt/qtgui/qopenglshader-obsolete.html
  • usr/share/doc/qt/qtgui/qopenglshader.html
  • usr/share/doc/qt/qtgui/qopenglshaderprogram-members.html
  • usr/share/doc/qt/qtgui/qopenglshaderprogram-obsolete.html
  • usr/share/doc/qt/qtgui/qopenglshaderprogram.html
  • usr/share/doc/qt/qtgui/qopengltexture-members.html
  • usr/share/doc/qt/qtgui/qopengltexture-obsolete.html
  • usr/share/doc/qt/qtgui/qopengltexture.html
  • usr/share/doc/qt/qtgui/qopengltextureblitter-members.html
  • usr/share/doc/qt/qtgui/qopengltextureblitter.html
  • usr/share/doc/qt/qtgui/qopengltimemonitor-members.html
  • usr/share/doc/qt/qtgui/qopengltimemonitor-obsolete.html
  • usr/share/doc/qt/qtgui/qopengltimemonitor.html
  • usr/share/doc/qt/qtgui/qopengltimerquery-members.html
  • usr/share/doc/qt/qtgui/qopengltimerquery-obsolete.html
  • usr/share/doc/qt/qtgui/qopengltimerquery.html
  • usr/share/doc/qt/qtgui/qopenglversionprofile-members.html
  • usr/share/doc/qt/qtgui/qopenglversionprofile.html
  • usr/share/doc/qt/qtgui/qopenglvertexarrayobject-binder-members.html
  • usr/share/doc/qt/qtgui/qopenglvertexarrayobject-binder.html
  • usr/share/doc/qt/qtgui/qopenglvertexarrayobject-members.html
  • usr/share/doc/qt/qtgui/qopenglvertexarrayobject-obsolete.html
  • usr/share/doc/qt/qtgui/qopenglvertexarrayobject.html
  • usr/share/doc/qt/qtgui/qopenglwindow-members.html
  • usr/share/doc/qt/qtgui/qopenglwindow-obsolete.html
  • usr/share/doc/qt/qtgui/qopenglwindow.html
  • usr/share/doc/qt/qtgui/qpagedpaintdevice-margins-members.html
  • usr/share/doc/qt/qtgui/qpagedpaintdevice-margins.html
  • usr/share/doc/qt/qtgui/qpagedpaintdevice-members.html
  • usr/share/doc/qt/qtgui/qpagedpaintdevice-obsolete.html
  • usr/share/doc/qt/qtgui/qpagedpaintdevice.html
  • usr/share/doc/qt/qtgui/qpagelayout-members.html
  • usr/share/doc/qt/qtgui/qpagelayout.html
  • usr/share/doc/qt/qtgui/qpagesize-members.html
  • usr/share/doc/qt/qtgui/qpagesize.html
  • usr/share/doc/qt/qtgui/qpaintdevice-members.html
  • usr/share/doc/qt/qtgui/qpaintdevice.html
  • usr/share/doc/qt/qtgui/qpaintdevicewindow-members.html
  • usr/share/doc/qt/qtgui/qpaintdevicewindow-obsolete.html
  • usr/share/doc/qt/qtgui/qpaintdevicewindow.html
  • usr/share/doc/qt/qtgui/qpaintengine-members.html
  • usr/share/doc/qt/qtgui/qpaintengine.html
  • usr/share/doc/qt/qtgui/qpaintenginestate-members.html
  • usr/share/doc/qt/qtgui/qpaintenginestate-obsolete.html
  • usr/share/doc/qt/qtgui/qpaintenginestate.html
  • usr/share/doc/qt/qtgui/qpainter-members.html
  • usr/share/doc/qt/qtgui/qpainter-obsolete.html
  • usr/share/doc/qt/qtgui/qpainter-pixmapfragment-members.html
  • usr/share/doc/qt/qtgui/qpainter-pixmapfragment.html
  • usr/share/doc/qt/qtgui/qpainter.html
  • usr/share/doc/qt/qtgui/qpainterpath-element-members.html
  • usr/share/doc/qt/qtgui/qpainterpath-element.html
  • usr/share/doc/qt/qtgui/qpainterpath-members.html
  • usr/share/doc/qt/qtgui/qpainterpath-obsolete.html
  • usr/share/doc/qt/qtgui/qpainterpath.html
  • usr/share/doc/qt/qtgui/qpainterpathstroker-members.html
  • usr/share/doc/qt/qtgui/qpainterpathstroker.html
  • usr/share/doc/qt/qtgui/qpaintevent-members.html
  • usr/share/doc/qt/qtgui/qpaintevent.html
  • usr/share/doc/qt/qtgui/qpalette-members.html
  • usr/share/doc/qt/qtgui/qpalette-obsolete.html
  • usr/share/doc/qt/qtgui/qpalette.html
  • usr/share/doc/qt/qtgui/qpdfwriter-members.html
  • usr/share/doc/qt/qtgui/qpdfwriter-obsolete.html
  • usr/share/doc/qt/qtgui/qpdfwriter.html
  • usr/share/doc/qt/qtgui/qpen-members.html
  • usr/share/doc/qt/qtgui/qpen.html
  • usr/share/doc/qt/qtgui/qpicture-members.html
  • usr/share/doc/qt/qtgui/qpicture-obsolete.html
  • usr/share/doc/qt/qtgui/qpicture.html
  • usr/share/doc/qt/qtgui/qpictureformatplugin-members.html
  • usr/share/doc/qt/qtgui/qpictureformatplugin-obsolete.html
  • usr/share/doc/qt/qtgui/qpictureformatplugin.html
  • usr/share/doc/qt/qtgui/qpictureio-members.html
  • usr/share/doc/qt/qtgui/qpictureio.html
  • usr/share/doc/qt/qtgui/qpixelformat-members.html
  • usr/share/doc/qt/qtgui/qpixelformat.html
  • usr/share/doc/qt/qtgui/qpixmap-members.html
  • usr/share/doc/qt/qtgui/qpixmap-obsolete.html
  • usr/share/doc/qt/qtgui/qpixmap.html
  • usr/share/doc/qt/qtgui/qpixmapcache-key-members.html
  • usr/share/doc/qt/qtgui/qpixmapcache-key.html
  • usr/share/doc/qt/qtgui/qpixmapcache-keydata-members.html
  • usr/share/doc/qt/qtgui/qpixmapcache-keydata.html
  • usr/share/doc/qt/qtgui/qpixmapcache-members.html
  • usr/share/doc/qt/qtgui/qpixmapcache-obsolete.html
  • usr/share/doc/qt/qtgui/qpixmapcache.html
  • usr/share/doc/qt/qtgui/qplatformsurfaceevent-members.html
  • usr/share/doc/qt/qtgui/qplatformsurfaceevent.html
  • usr/share/doc/qt/qtgui/qpointingdeviceuniqueid-members.html
  • usr/share/doc/qt/qtgui/qpointingdeviceuniqueid.html
  • usr/share/doc/qt/qtgui/qpolygon-members.html
  • usr/share/doc/qt/qtgui/qpolygon.html
  • usr/share/doc/qt/qtgui/qpolygonf-members.html
  • usr/share/doc/qt/qtgui/qpolygonf.html
  • usr/share/doc/qt/qtgui/qquaternion-members.html
  • usr/share/doc/qt/qtgui/qquaternion.html
  • usr/share/doc/qt/qtgui/qradialgradient-members.html
  • usr/share/doc/qt/qtgui/qradialgradient.html
  • usr/share/doc/qt/qtgui/qrasterpaintengine-members.html
  • usr/share/doc/qt/qtgui/qrasterpaintengine.html
  • usr/share/doc/qt/qtgui/qrasterwindow-members.html
  • usr/share/doc/qt/qtgui/qrasterwindow-obsolete.html
  • usr/share/doc/qt/qtgui/qrasterwindow.html
  • usr/share/doc/qt/qtgui/qrawfont-members.html
  • usr/share/doc/qt/qtgui/qrawfont.html
  • usr/share/doc/qt/qtgui/qregexpvalidator-members.html
  • usr/share/doc/qt/qtgui/qregexpvalidator-obsolete.html
  • usr/share/doc/qt/qtgui/qregexpvalidator.html
  • usr/share/doc/qt/qtgui/qregion-members.html
  • usr/share/doc/qt/qtgui/qregion.html
  • usr/share/doc/qt/qtgui/qregularexpressionvalidator-members.html
  • usr/share/doc/qt/qtgui/qregularexpressionvalidator-obsolete.html
  • usr/share/doc/qt/qtgui/qregularexpressionvalidator.html
  • usr/share/doc/qt/qtgui/qresizeevent-members.html
  • usr/share/doc/qt/qtgui/qresizeevent.html
  • usr/share/doc/qt/qtgui/qrgba64-members.html
  • usr/share/doc/qt/qtgui/qrgba64.html
  • usr/share/doc/qt/qtgui/qscreen-members.html
  • usr/share/doc/qt/qtgui/qscreen-obsolete.html
  • usr/share/doc/qt/qtgui/qscreen.html
  • usr/share/doc/qt/qtgui/qscrollevent-members.html
  • usr/share/doc/qt/qtgui/qscrollevent.html
  • usr/share/doc/qt/qtgui/qscrollprepareevent-members.html
  • usr/share/doc/qt/qtgui/qscrollprepareevent.html
  • usr/share/doc/qt/qtgui/qsessionmanager-members.html
  • usr/share/doc/qt/qtgui/qsessionmanager-obsolete.html
  • usr/share/doc/qt/qtgui/qsessionmanager.html
  • usr/share/doc/qt/qtgui/qshortcutevent-members.html
  • usr/share/doc/qt/qtgui/qshortcutevent.html
  • usr/share/doc/qt/qtgui/qshowevent-members.html
  • usr/share/doc/qt/qtgui/qshowevent.html
  • usr/share/doc/qt/qtgui/qstandarditem-members.html
  • usr/share/doc/qt/qtgui/qstandarditem.html
  • usr/share/doc/qt/qtgui/qstandarditemmodel-members.html
  • usr/share/doc/qt/qtgui/qstandarditemmodel-obsolete.html
  • usr/share/doc/qt/qtgui/qstandarditemmodel.html
  • usr/share/doc/qt/qtgui/qstatictext-members.html
  • usr/share/doc/qt/qtgui/qstatictext.html
  • usr/share/doc/qt/qtgui/qstatustipevent-members.html
  • usr/share/doc/qt/qtgui/qstatustipevent.html
  • usr/share/doc/qt/qtgui/qstylehints-members.html
  • usr/share/doc/qt/qtgui/qstylehints-obsolete.html
  • usr/share/doc/qt/qtgui/qstylehints.html
  • usr/share/doc/qt/qtgui/qsupportedwritingsystems-members.html
  • usr/share/doc/qt/qtgui/qsupportedwritingsystems.html
  • usr/share/doc/qt/qtgui/qsurface-members.html
  • usr/share/doc/qt/qtgui/qsurface.html
  • usr/share/doc/qt/qtgui/qsurfaceformat-members.html
  • usr/share/doc/qt/qtgui/qsurfaceformat-obsolete.html
  • usr/share/doc/qt/qtgui/qsurfaceformat.html
  • usr/share/doc/qt/qtgui/qsyntaxhighlighter-members.html
  • usr/share/doc/qt/qtgui/qsyntaxhighlighter-obsolete.html
  • usr/share/doc/qt/qtgui/qsyntaxhighlighter.html
  • usr/share/doc/qt/qtgui/qt-sub-qtgui.html
  • usr/share/doc/qt/qtgui/qtabletevent-members.html
  • usr/share/doc/qt/qtgui/qtabletevent-obsolete.html
  • usr/share/doc/qt/qtgui/qtabletevent.html
  • usr/share/doc/qt/qtgui/qtextblock-iterator-members.html
  • usr/share/doc/qt/qtgui/qtextblock-iterator.html
  • usr/share/doc/qt/qtgui/qtextblock-members.html
  • usr/share/doc/qt/qtgui/qtextblock.html
  • usr/share/doc/qt/qtgui/qtextblockformat-members.html
  • usr/share/doc/qt/qtgui/qtextblockformat.html
  • usr/share/doc/qt/qtgui/qtextblockgroup-members.html
  • usr/share/doc/qt/qtgui/qtextblockgroup-obsolete.html
  • usr/share/doc/qt/qtgui/qtextblockgroup.html
  • usr/share/doc/qt/qtgui/qtextblockuserdata-members.html
  • usr/share/doc/qt/qtgui/qtextblockuserdata.html
  • usr/share/doc/qt/qtgui/qtextcharformat-members.html
  • usr/share/doc/qt/qtgui/qtextcharformat.html
  • usr/share/doc/qt/qtgui/qtextcursor-members.html
  • usr/share/doc/qt/qtgui/qtextcursor.html
  • usr/share/doc/qt/qtgui/qtextdocument-members.html
  • usr/share/doc/qt/qtgui/qtextdocument-obsolete.html
  • usr/share/doc/qt/qtgui/qtextdocument.html
  • usr/share/doc/qt/qtgui/qtextdocumentfragment-members.html
  • usr/share/doc/qt/qtgui/qtextdocumentfragment.html
  • usr/share/doc/qt/qtgui/qtextdocumentwriter-members.html
  • usr/share/doc/qt/qtgui/qtextdocumentwriter.html
  • usr/share/doc/qt/qtgui/qtextformat-members.html
  • usr/share/doc/qt/qtgui/qtextformat.html
  • usr/share/doc/qt/qtgui/qtextfragment-members.html
  • usr/share/doc/qt/qtgui/qtextfragment.html
  • usr/share/doc/qt/qtgui/qtextframe-iterator-members.html
  • usr/share/doc/qt/qtgui/qtextframe-iterator.html
  • usr/share/doc/qt/qtgui/qtextframe-members.html
  • usr/share/doc/qt/qtgui/qtextframe-obsolete.html
  • usr/share/doc/qt/qtgui/qtextframe.html
  • usr/share/doc/qt/qtgui/qtextframeformat-members.html
  • usr/share/doc/qt/qtgui/qtextframeformat.html
  • usr/share/doc/qt/qtgui/qtextimageformat-members.html
  • usr/share/doc/qt/qtgui/qtextimageformat.html
  • usr/share/doc/qt/qtgui/qtextinlineobject-members.html
  • usr/share/doc/qt/qtgui/qtextinlineobject.html
  • usr/share/doc/qt/qtgui/qtextitem-members.html
  • usr/share/doc/qt/qtgui/qtextitem.html
  • usr/share/doc/qt/qtgui/qtextlayout-formatrange-members.html
  • usr/share/doc/qt/qtgui/qtextlayout-formatrange.html
  • usr/share/doc/qt/qtgui/qtextlayout-members.html
  • usr/share/doc/qt/qtgui/qtextlayout-obsolete.html
  • usr/share/doc/qt/qtgui/qtextlayout.html
  • usr/share/doc/qt/qtgui/qtextlength-members.html
  • usr/share/doc/qt/qtgui/qtextlength.html
  • usr/share/doc/qt/qtgui/qtextline-members.html
  • usr/share/doc/qt/qtgui/qtextline.html
  • usr/share/doc/qt/qtgui/qtextlist-members.html
  • usr/share/doc/qt/qtgui/qtextlist-obsolete.html
  • usr/share/doc/qt/qtgui/qtextlist.html
  • usr/share/doc/qt/qtgui/qtextlistformat-members.html
  • usr/share/doc/qt/qtgui/qtextlistformat.html
  • usr/share/doc/qt/qtgui/qtextobject-members.html
  • usr/share/doc/qt/qtgui/qtextobject-obsolete.html
  • usr/share/doc/qt/qtgui/qtextobject.html
  • usr/share/doc/qt/qtgui/qtextobjectinterface-members.html
  • usr/share/doc/qt/qtgui/qtextobjectinterface.html
  • usr/share/doc/qt/qtgui/qtextoption-members.html
  • usr/share/doc/qt/qtgui/qtextoption-tab-members.html
  • usr/share/doc/qt/qtgui/qtextoption-tab.html
  • usr/share/doc/qt/qtgui/qtextoption.html
  • usr/share/doc/qt/qtgui/qtexttable-members.html
  • usr/share/doc/qt/qtgui/qtexttable-obsolete.html
  • usr/share/doc/qt/qtgui/qtexttable.html
  • usr/share/doc/qt/qtgui/qtexttablecell-members.html
  • usr/share/doc/qt/qtgui/qtexttablecell.html
  • usr/share/doc/qt/qtgui/qtexttablecellformat-members.html
  • usr/share/doc/qt/qtgui/qtexttablecellformat.html
  • usr/share/doc/qt/qtgui/qtexttableformat-members.html
  • usr/share/doc/qt/qtgui/qtexttableformat.html
  • usr/share/doc/qt/qtgui/qtgui-analogclock-analogclock-pro.html
  • usr/share/doc/qt/qtgui/qtgui-analogclock-example.html
  • usr/share/doc/qt/qtgui/qtgui-analogclock-main-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-android-native-style.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-angle-arrayboundsclamper.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-angle-murmurhash.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-angle-systeminfo.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-angle-trace-event.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-angle.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-cocoa-platform-plugin.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-dejayvu.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-freetype-bdf.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-freetype-pcf.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-freetype-zlib.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-freetype.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-grayraster.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-harfbuzz-ng.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-harfbuzz.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-iaccessible2.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-icc-srgb-color-profile.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-libjpeg.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-libpng.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-opengl-es2-headers.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-opengl-headers.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-pixman.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-smooth-scaling-algorithm.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-vera-font.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-vulkan-xml-spec.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-webgradients.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-wintab.html
  • usr/share/doc/qt/qtgui/qtgui-attribution-xcb.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-camera-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-camera-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-example.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-hellovulkancubes-pro.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-hellovulkancubes-qrc.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-main-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-mainwindow-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-mainwindow-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-mesh-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-mesh-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-renderer-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-renderer-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-shader-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-shader-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-vulkanwindow-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-vulkanwindow-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantexture-example.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantexture-hellovulkantexture-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantexture-hellovulkantexture-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantexture-hellovulkantexture-pro.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantexture-hellovulkantexture-qrc.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantexture-main-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantriangle-example.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantriangle-hellovulkantriangle-pro.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantriangle-hellovulkantriangle-qrc.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkantriangle-main-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwidget-example.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-pro.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-qrc.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwidget-main-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwindow-example.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-h.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-pro.html
  • usr/share/doc/qt/qtgui/qtgui-hellovulkanwindow-main-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-index.html
  • usr/share/doc/qt/qtgui/qtgui-module.html
  • usr/share/doc/qt/qtgui/qtgui-openglwindow-example.html
  • usr/share/doc/qt/qtgui/qtgui-openglwindow-main-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-openglwindow-openglwindow-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-openglwindow-openglwindow-h.html
  • usr/share/doc/qt/qtgui/qtgui-openglwindow-openglwindow-pro.html
  • usr/share/doc/qt/qtgui/qtgui-rasterwindow-example.html
  • usr/share/doc/qt/qtgui/qtgui-rasterwindow-main-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-rasterwindow-rasterwindow-cpp.html
  • usr/share/doc/qt/qtgui/qtgui-rasterwindow-rasterwindow-h.html
  • usr/share/doc/qt/qtgui/qtgui-rasterwindow-rasterwindow-pro.html
  • usr/share/doc/qt/qtgui/qtgui.index
  • usr/share/doc/qt/qtgui/qtgui.qhp
  • usr/share/doc/qt/qtgui/qtgui.qhp.sha1
  • usr/share/doc/qt/qtgui/qtgui.tags
  • usr/share/doc/qt/qtgui/qtouchdevice-members.html
  • usr/share/doc/qt/qtgui/qtouchdevice.html
  • usr/share/doc/qt/qtgui/qtouchevent-members.html
  • usr/share/doc/qt/qtgui/qtouchevent-obsolete.html
  • usr/share/doc/qt/qtgui/qtouchevent-touchpoint-members.html
  • usr/share/doc/qt/qtgui/qtouchevent-touchpoint-obsolete.html
  • usr/share/doc/qt/qtgui/qtouchevent-touchpoint.html
  • usr/share/doc/qt/qtgui/qtouchevent.html
  • usr/share/doc/qt/qtgui/qtransform-members.html
  • usr/share/doc/qt/qtgui/qtransform.html
  • usr/share/doc/qt/qtgui/qvalidator-members.html
  • usr/share/doc/qt/qtgui/qvalidator-obsolete.html
  • usr/share/doc/qt/qtgui/qvalidator.html
  • usr/share/doc/qt/qtgui/qvector2d-members.html
  • usr/share/doc/qt/qtgui/qvector2d.html
  • usr/share/doc/qt/qtgui/qvector3d-members.html
  • usr/share/doc/qt/qtgui/qvector3d.html
  • usr/share/doc/qt/qtgui/qvector4d-members.html
  • usr/share/doc/qt/qtgui/qvector4d.html
  • usr/share/doc/qt/qtgui/qvulkandevicefunctions-members.html
  • usr/share/doc/qt/qtgui/qvulkandevicefunctions.html
  • usr/share/doc/qt/qtgui/qvulkanextension-members.html
  • usr/share/doc/qt/qtgui/qvulkanextension.html
  • usr/share/doc/qt/qtgui/qvulkanfunctions-members.html
  • usr/share/doc/qt/qtgui/qvulkanfunctions.html
  • usr/share/doc/qt/qtgui/qvulkaninfovector-members.html
  • usr/share/doc/qt/qtgui/qvulkaninfovector.html
  • usr/share/doc/qt/qtgui/qvulkaninstance-members.html
  • usr/share/doc/qt/qtgui/qvulkaninstance.html
  • usr/share/doc/qt/qtgui/qvulkanlayer-members.html
  • usr/share/doc/qt/qtgui/qvulkanlayer.html
  • usr/share/doc/qt/qtgui/qvulkanwindow-members.html
  • usr/share/doc/qt/qtgui/qvulkanwindow-obsolete.html
  • usr/share/doc/qt/qtgui/qvulkanwindow.html
  • usr/share/doc/qt/qtgui/qvulkanwindowrenderer-members.html
  • usr/share/doc/qt/qtgui/qvulkanwindowrenderer.html
  • usr/share/doc/qt/qtgui/qwhatsthisclickedevent-members.html
  • usr/share/doc/qt/qtgui/qwhatsthisclickedevent.html
  • usr/share/doc/qt/qtgui/qwheelevent-members.html
  • usr/share/doc/qt/qtgui/qwheelevent-obsolete.html
  • usr/share/doc/qt/qtgui/qwheelevent.html
  • usr/share/doc/qt/qtgui/qwindow-members.html
  • usr/share/doc/qt/qtgui/qwindow-obsolete.html
  • usr/share/doc/qt/qtgui/qwindow.html
  • usr/share/doc/qt/qtgui/qwindowstatechangeevent-members.html
  • usr/share/doc/qt/qtgui/qwindowstatechangeevent.html
  • usr/share/doc/qt/qtgui/richtext-advanced-processing.html
  • usr/share/doc/qt/qtgui/richtext-common-tasks.html
  • usr/share/doc/qt/qtgui/richtext-cursor.html
  • usr/share/doc/qt/qtgui/richtext-html-subset.html
  • usr/share/doc/qt/qtgui/richtext-layouts.html
  • usr/share/doc/qt/qtgui/richtext-processing.html
  • usr/share/doc/qt/qtgui/richtext-structure.html
  • usr/share/doc/qt/qtgui/richtext.html
  • usr/share/doc/qt/qtgui/style/
  • usr/share/doc/qt/qtgui/style/offline-simple.css
  • usr/share/doc/qt/qtgui/style/offline.css
  • usr/share/doc/qt/qthelp.qch
  • usr/share/doc/qt/qthelp/
  • usr/share/doc/qt/qthelp/examples-manifest.xml
  • usr/share/doc/qt/qthelp/examples-qthelp.html
  • usr/share/doc/qt/qthelp/helpsystem.html
  • usr/share/doc/qt/qthelp/images/
  • usr/share/doc/qt/qthelp/images/arrow_bc.png
  • usr/share/doc/qt/qthelp/images/bgrContent.png
  • usr/share/doc/qt/qthelp/images/btn_next.png
  • usr/share/doc/qt/qthelp/images/btn_prev.png
  • usr/share/doc/qt/qthelp/images/bullet_dn.png
  • usr/share/doc/qt/qthelp/images/bullet_sq.png
  • usr/share/doc/qt/qthelp/images/home.png
  • usr/share/doc/qt/qthelp/images/ico_note.png
  • usr/share/doc/qt/qthelp/images/ico_note_attention.png
  • usr/share/doc/qt/qthelp/images/ico_out.png
  • usr/share/doc/qt/qthelp/images/logo.png
  • usr/share/doc/qt/qthelp/qhelpcontentitem-members.html
  • usr/share/doc/qt/qthelp/qhelpcontentitem.html
  • usr/share/doc/qt/qthelp/qhelpcontentmodel-members.html
  • usr/share/doc/qt/qthelp/qhelpcontentmodel-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpcontentmodel.html
  • usr/share/doc/qt/qthelp/qhelpcontentwidget-members.html
  • usr/share/doc/qt/qthelp/qhelpcontentwidget-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpcontentwidget.html
  • usr/share/doc/qt/qthelp/qhelpengine-members.html
  • usr/share/doc/qt/qthelp/qhelpengine-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpengine.html
  • usr/share/doc/qt/qthelp/qhelpenginecore-members.html
  • usr/share/doc/qt/qthelp/qhelpenginecore-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpenginecore.html
  • usr/share/doc/qt/qthelp/qhelpindexmodel-members.html
  • usr/share/doc/qt/qthelp/qhelpindexmodel-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpindexmodel.html
  • usr/share/doc/qt/qthelp/qhelpindexwidget-members.html
  • usr/share/doc/qt/qthelp/qhelpindexwidget-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpindexwidget.html
  • usr/share/doc/qt/qthelp/qhelpsearchengine-members.html
  • usr/share/doc/qt/qthelp/qhelpsearchengine-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpsearchengine.html
  • usr/share/doc/qt/qthelp/qhelpsearchquery-members.html
  • usr/share/doc/qt/qthelp/qhelpsearchquery.html
  • usr/share/doc/qt/qthelp/qhelpsearchquerywidget-members.html
  • usr/share/doc/qt/qthelp/qhelpsearchquerywidget-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpsearchquerywidget.html
  • usr/share/doc/qt/qthelp/qhelpsearchresult-members.html
  • usr/share/doc/qt/qthelp/qhelpsearchresult.html
  • usr/share/doc/qt/qthelp/qhelpsearchresultwidget-members.html
  • usr/share/doc/qt/qthelp/qhelpsearchresultwidget-obsolete.html
  • usr/share/doc/qt/qthelp/qhelpsearchresultwidget.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-contextsensitivehelp-pro.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhcp.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhp.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-example.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-helpbrowser-cpp.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-helpbrowser-h.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-main-cpp.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-cpp.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-h.html
  • usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-ui.html
  • usr/share/doc/qt/qthelp/qthelp-framework.html
  • usr/share/doc/qt/qthelp/qthelp-index.html
  • usr/share/doc/qt/qthelp/qthelp-module.html
  • usr/share/doc/qt/qthelp/qthelp.index
  • usr/share/doc/qt/qthelp/qthelp.qhp
  • usr/share/doc/qt/qthelp/qthelp.qhp.sha1
  • usr/share/doc/qt/qthelp/qthelpproject.html
  • usr/share/doc/qt/qthelp/style/
  • usr/share/doc/qt/qthelp/style/offline-simple.css
  • usr/share/doc/qt/qthelp/style/offline.css
  • usr/share/doc/qt/qtimageformats.qch
  • usr/share/doc/qt/qtimageformats/
  • usr/share/doc/qt/qtimageformats/images/
  • usr/share/doc/qt/qtimageformats/images/arrow_bc.png
  • usr/share/doc/qt/qtimageformats/images/bgrContent.png
  • usr/share/doc/qt/qtimageformats/images/btn_next.png
  • usr/share/doc/qt/qtimageformats/images/btn_prev.png
  • usr/share/doc/qt/qtimageformats/images/bullet_dn.png
  • usr/share/doc/qt/qtimageformats/images/bullet_sq.png
  • usr/share/doc/qt/qtimageformats/images/home.png
  • usr/share/doc/qt/qtimageformats/images/ico_note.png
  • usr/share/doc/qt/qtimageformats/images/ico_note_attention.png
  • usr/share/doc/qt/qtimageformats/images/ico_out.png
  • usr/share/doc/qt/qtimageformats/images/logo.png
  • usr/share/doc/qt/qtimageformats/qtimageformats-attribution-libtiff.html
  • usr/share/doc/qt/qtimageformats/qtimageformats-attribution-libwebp.html
  • usr/share/doc/qt/qtimageformats/qtimageformats-index.html
  • usr/share/doc/qt/qtimageformats/qtimageformats.index
  • usr/share/doc/qt/qtimageformats/qtimageformats.qhp
  • usr/share/doc/qt/qtimageformats/qtimageformats.qhp.sha1
  • usr/share/doc/qt/qtimageformats/style/
  • usr/share/doc/qt/qtimageformats/style/offline-simple.css
  • usr/share/doc/qt/qtimageformats/style/offline.css
  • usr/share/doc/qt/qtlabscalendar.qch
  • usr/share/doc/qt/qtlabscalendar/
  • usr/share/doc/qt/qtlabscalendar/images/
  • usr/share/doc/qt/qtlabscalendar/images/arrow_bc.png
  • usr/share/doc/qt/qtlabscalendar/images/bgrContent.png
  • usr/share/doc/qt/qtlabscalendar/images/btn_next.png
  • usr/share/doc/qt/qtlabscalendar/images/btn_prev.png
  • usr/share/doc/qt/qtlabscalendar/images/bullet_dn.png
  • usr/share/doc/qt/qtlabscalendar/images/bullet_sq.png
  • usr/share/doc/qt/qtlabscalendar/images/home.png
  • usr/share/doc/qt/qtlabscalendar/images/ico_note.png
  • usr/share/doc/qt/qtlabscalendar/images/ico_note_attention.png
  • usr/share/doc/qt/qtlabscalendar/images/ico_out.png
  • usr/share/doc/qt/qtlabscalendar/images/logo.png
  • usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-dayofweekrow-layout.png
  • usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-dayofweekrow.png
  • usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-monthgrid-layout.png
  • usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-monthgrid.png
  • usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn-layout.png
  • usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn.png
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-calendar-members.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-calendar.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-calendarmodel-members.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-calendarmodel.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow-members.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-monthgrid-members.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-monthgrid.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn-members.html
  • usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn.html
  • usr/share/doc/qt/qtlabscalendar/qt-labs-calendar-qmlmodule.html
  • usr/share/doc/qt/qtlabscalendar/qtlabscalendar-index.html
  • usr/share/doc/qt/qtlabscalendar/qtlabscalendar.index
  • usr/share/doc/qt/qtlabscalendar/qtlabscalendar.qhp
  • usr/share/doc/qt/qtlabscalendar/qtlabscalendar.qhp.sha1
  • usr/share/doc/qt/qtlabscalendar/qtlabscalendar.tags
  • usr/share/doc/qt/qtlabscalendar/style/
  • usr/share/doc/qt/qtlabscalendar/style/offline-simple.css
  • usr/share/doc/qt/qtlabscalendar/style/offline.css
  • usr/share/doc/qt/qtlabsplatform.qch
  • usr/share/doc/qt/qtlabsplatform/
  • usr/share/doc/qt/qtlabsplatform/images/
  • usr/share/doc/qt/qtlabsplatform/images/arrow_bc.png
  • usr/share/doc/qt/qtlabsplatform/images/bgrContent.png
  • usr/share/doc/qt/qtlabsplatform/images/btn_next.png
  • usr/share/doc/qt/qtlabsplatform/images/btn_prev.png
  • usr/share/doc/qt/qtlabsplatform/images/bullet_dn.png
  • usr/share/doc/qt/qtlabsplatform/images/bullet_sq.png
  • usr/share/doc/qt/qtlabsplatform/images/home.png
  • usr/share/doc/qt/qtlabsplatform/images/ico_note.png
  • usr/share/doc/qt/qtlabsplatform/images/ico_note_attention.png
  • usr/share/doc/qt/qtlabsplatform/images/ico_out.png
  • usr/share/doc/qt/qtlabsplatform/images/logo.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-colordialog-gtk.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-filedialog-gtk.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-folderdialog-gtk.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-fontdialog-gtk.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-menu.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-menubar.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-messagedialog-android.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-messagedialog-informative-android.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-systemtrayicon-menu.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-systemtrayicon-message.png
  • usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-systemtrayicon.png
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-colordialog-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-colordialog.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-dialog-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-dialog.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-filedialog-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-filedialog.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-folderdialog-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-folderdialog.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-fontdialog-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-fontdialog.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menu-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menu-obsolete.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menu.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menubar-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menubar.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitem-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitem-obsolete.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitem.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitemgroup-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitemgroup.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuseparator-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuseparator.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-messagedialog-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-messagedialog.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-standardpaths-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-standardpaths.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-members.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-obsolete.html
  • usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-systemtrayicon.html
  • usr/share/doc/qt/qtlabsplatform/qt-labs-platform-qmlmodule.html
  • usr/share/doc/qt/qtlabsplatform/qtlabsplatform-index.html
  • usr/share/doc/qt/qtlabsplatform/qtlabsplatform.index
  • usr/share/doc/qt/qtlabsplatform/qtlabsplatform.qhp
  • usr/share/doc/qt/qtlabsplatform/qtlabsplatform.qhp.sha1
  • usr/share/doc/qt/qtlabsplatform/qtlabsplatform.tags
  • usr/share/doc/qt/qtlabsplatform/style/
  • usr/share/doc/qt/qtlabsplatform/style/offline-simple.css
  • usr/share/doc/qt/qtlabsplatform/style/offline.css
  • usr/share/doc/qt/qtlinguist.qch
  • usr/share/doc/qt/qtlinguist/
  • usr/share/doc/qt/qtlinguist/examples-linguist.html
  • usr/share/doc/qt/qtlinguist/examples-manifest.xml
  • usr/share/doc/qt/qtlinguist/images/
  • usr/share/doc/qt/qtlinguist/images/arrow_bc.png
  • usr/share/doc/qt/qtlinguist/images/bgrContent.png
  • usr/share/doc/qt/qtlinguist/images/btn_next.png
  • usr/share/doc/qt/qtlinguist/images/btn_prev.png
  • usr/share/doc/qt/qtlinguist/images/bullet_dn.png
  • usr/share/doc/qt/qtlinguist/images/bullet_sq.png
  • usr/share/doc/qt/qtlinguist/images/home.png
  • usr/share/doc/qt/qtlinguist/images/ico_note.png
  • usr/share/doc/qt/qtlinguist/images/ico_note_attention.png
  • usr/share/doc/qt/qtlinguist/images/ico_out.png
  • usr/share/doc/qt/qtlinguist/images/linguist-arrowpad_en.png
  • usr/share/doc/qt/qtlinguist/images/linguist-arrowpad_fr.png
  • usr/share/doc/qt/qtlinguist/images/linguist-arrowpad_nl.png
  • usr/share/doc/qt/qtlinguist/images/linguist-batchtranslation.png
  • usr/share/doc/qt/qtlinguist/images/linguist-check-empty.png
  • usr/share/doc/qt/qtlinguist/images/linguist-check-obsolete.png
  • usr/share/doc/qt/qtlinguist/images/linguist-check-off.png
  • usr/share/doc/qt/qtlinguist/images/linguist-check-on.png
  • usr/share/doc/qt/qtlinguist/images/linguist-check-warning.png
  • usr/share/doc/qt/qtlinguist/images/linguist-danger.png
  • usr/share/doc/qt/qtlinguist/images/linguist-doneandnext.png
  • usr/share/doc/qt/qtlinguist/images/linguist-hellotr_en.png
  • usr/share/doc/qt/qtlinguist/images/linguist-hellotr_la.png
  • usr/share/doc/qt/qtlinguist/images/linguist-linguist.png
  • usr/share/doc/qt/qtlinguist/images/linguist-linguist_2.png
  • usr/share/doc/qt/qtlinguist/images/linguist-phrasebookdialog.png
  • usr/share/doc/qt/qtlinguist/images/linguist-translationfilesettings.png
  • usr/share/doc/qt/qtlinguist/images/linguist-trollprint_10_en.png
  • usr/share/doc/qt/qtlinguist/images/linguist-trollprint_10_pt_bad.png
  • usr/share/doc/qt/qtlinguist/images/linguist-trollprint_10_pt_good.png
  • usr/share/doc/qt/qtlinguist/images/linguist-trollprint_11_en.png
  • usr/share/doc/qt/qtlinguist/images/linguist-trollprint_11_pt.png
  • usr/share/doc/qt/qtlinguist/images/logo.png
  • usr/share/doc/qt/qtlinguist/linguist-id-based-i18n.html
  • usr/share/doc/qt/qtlinguist/linguist-manager.html
  • usr/share/doc/qt/qtlinguist/linguist-overview.html
  • usr/share/doc/qt/qtlinguist/linguist-programmers.html
  • usr/share/doc/qt/qtlinguist/linguist-translators.html
  • usr/share/doc/qt/qtlinguist/linguist-ts-file-format.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-arrowpad-arrowpad-cpp.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-arrowpad-arrowpad-h.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-arrowpad-arrowpad-pro.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-arrowpad-example.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-arrowpad-main-cpp.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-arrowpad-mainwindow-cpp.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-arrowpad-mainwindow-h.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-hellotr-example.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-hellotr-hellotr-pro.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-hellotr-main-cpp.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-index.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-trollprint-example.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-trollprint-main-cpp.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-trollprint-mainwindow-cpp.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-trollprint-mainwindow-h.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-trollprint-printpanel-cpp.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-trollprint-printpanel-h.html
  • usr/share/doc/qt/qtlinguist/qtlinguist-trollprint-trollprint-pro.html
  • usr/share/doc/qt/qtlinguist/qtlinguist.index
  • usr/share/doc/qt/qtlinguist/qtlinguist.qhp
  • usr/share/doc/qt/qtlinguist/qtlinguist.qhp.sha1
  • usr/share/doc/qt/qtlinguist/style/
  • usr/share/doc/qt/qtlinguist/style/offline-simple.css
  • usr/share/doc/qt/qtlinguist/style/offline.css
  • usr/share/doc/qt/qtlocation.qch
  • usr/share/doc/qt/qtlocation/
  • usr/share/doc/qt/qtlocation/examples-manifest.xml
  • usr/share/doc/qt/qtlocation/images/
  • usr/share/doc/qt/qtlocation/images/api-mapcircle.png
  • usr/share/doc/qt/qtlocation/images/api-mapitemgroup.png
  • usr/share/doc/qt/qtlocation/images/api-mappolygon.png
  • usr/share/doc/qt/qtlocation/images/api-mappolyline.png
  • usr/share/doc/qt/qtlocation/images/api-mapquickitem-anchor.png
  • usr/share/doc/qt/qtlocation/images/api-mapquickitem.png
  • usr/share/doc/qt/qtlocation/images/api-maprectangle.png
  • usr/share/doc/qt/qtlocation/images/arrow_bc.png
  • usr/share/doc/qt/qtlocation/images/bgrContent.png
  • usr/share/doc/qt/qtlocation/images/btn_next.png
  • usr/share/doc/qt/qtlocation/images/btn_prev.png
  • usr/share/doc/qt/qtlocation/images/bullet_dn.png
  • usr/share/doc/qt/qtlocation/images/bullet_sq.png
  • usr/share/doc/qt/qtlocation/images/home.png
  • usr/share/doc/qt/qtlocation/images/ico_note.png
  • usr/share/doc/qt/qtlocation/images/ico_note_attention.png
  • usr/share/doc/qt/qtlocation/images/ico_out.png
  • usr/share/doc/qt/qtlocation/images/logo.png
  • usr/share/doc/qt/qtlocation/images/mapviewer.png
  • usr/share/doc/qt/qtlocation/images/minimal_map.png
  • usr/share/doc/qt/qtlocation/images/places.png
  • usr/share/doc/qt/qtlocation/images/places_list.png
  • usr/share/doc/qt/qtlocation/images/places_map.png
  • usr/share/doc/qt/qtlocation/images/planespotter.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/
  • usr/share/doc/qt/qtlocation/images/used-in-examples/mapviewer/
  • usr/share/doc/qt/qtlocation/images/used-in-examples/mapviewer/resources/
  • usr/share/doc/qt/qtlocation/images/used-in-examples/mapviewer/resources/icon.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/mapviewer/resources/marker.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/mapviewer/resources/scale.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/mapviewer/resources/scale_end.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/categories.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/left.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/marker.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/right.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/scale.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/scale_end.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/search.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places/resources/star.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places_list/
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places_list/marker.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places_map/
  • usr/share/doc/qt/qtlocation/images/used-in-examples/places_map/marker.png
  • usr/share/doc/qt/qtlocation/images/used-in-examples/planespotter/
  • usr/share/doc/qt/qtlocation/images/used-in-examples/planespotter/airplane.png
  • usr/share/doc/qt/qtlocation/location-cpp-qml.html
  • usr/share/doc/qt/qtlocation/location-maps-cpp.html
  • usr/share/doc/qt/qtlocation/location-maps-qml.html
  • usr/share/doc/qt/qtlocation/location-places-backend.html
  • usr/share/doc/qt/qtlocation/location-places-cpp.html
  • usr/share/doc/qt/qtlocation/location-places-qml.html
  • usr/share/doc/qt/qtlocation/location-plugin-esri.html
  • usr/share/doc/qt/qtlocation/location-plugin-here.html
  • usr/share/doc/qt/qtlocation/location-plugin-itemsoverlay.html
  • usr/share/doc/qt/qtlocation/location-plugin-mapbox.html
  • usr/share/doc/qt/qtlocation/location-plugin-mapboxgl.html
  • usr/share/doc/qt/qtlocation/location-plugin-osm.html
  • usr/share/doc/qt/qtlocation/qgeocodereply-members.html
  • usr/share/doc/qt/qtlocation/qgeocodereply-obsolete.html
  • usr/share/doc/qt/qtlocation/qgeocodereply.html
  • usr/share/doc/qt/qtlocation/qgeocodingmanager-members.html
  • usr/share/doc/qt/qtlocation/qgeocodingmanager-obsolete.html
  • usr/share/doc/qt/qtlocation/qgeocodingmanager.html
  • usr/share/doc/qt/qtlocation/qgeocodingmanagerengine-members.html
  • usr/share/doc/qt/qtlocation/qgeocodingmanagerengine-obsolete.html
  • usr/share/doc/qt/qtlocation/qgeocodingmanagerengine.html
  • usr/share/doc/qt/qtlocation/qgeomaneuver-members.html
  • usr/share/doc/qt/qtlocation/qgeomaneuver.html
  • usr/share/doc/qt/qtlocation/qgeoroute-members.html
  • usr/share/doc/qt/qtlocation/qgeoroute.html
  • usr/share/doc/qt/qtlocation/qgeorouteleg-members.html
  • usr/share/doc/qt/qtlocation/qgeorouteleg.html
  • usr/share/doc/qt/qtlocation/qgeoroutereply-members.html
  • usr/share/doc/qt/qtlocation/qgeoroutereply-obsolete.html
  • usr/share/doc/qt/qtlocation/qgeoroutereply.html
  • usr/share/doc/qt/qtlocation/qgeorouterequest-members.html
  • usr/share/doc/qt/qtlocation/qgeorouterequest.html
  • usr/share/doc/qt/qtlocation/qgeoroutesegment-members.html
  • usr/share/doc/qt/qtlocation/qgeoroutesegment.html
  • usr/share/doc/qt/qtlocation/qgeoroutingmanager-members.html
  • usr/share/doc/qt/qtlocation/qgeoroutingmanager-obsolete.html
  • usr/share/doc/qt/qtlocation/qgeoroutingmanager.html
  • usr/share/doc/qt/qtlocation/qgeoroutingmanagerengine-members.html
  • usr/share/doc/qt/qtlocation/qgeoroutingmanagerengine-obsolete.html
  • usr/share/doc/qt/qtlocation/qgeoroutingmanagerengine.html
  • usr/share/doc/qt/qtlocation/qgeoserviceprovider-members.html
  • usr/share/doc/qt/qtlocation/qgeoserviceprovider-obsolete.html
  • usr/share/doc/qt/qtlocation/qgeoserviceprovider.html
  • usr/share/doc/qt/qtlocation/qgeoserviceproviderfactory-members.html
  • usr/share/doc/qt/qtlocation/qgeoserviceproviderfactory.html
  • usr/share/doc/qt/qtlocation/qgeoserviceproviderfactoryv2-members.html
  • usr/share/doc/qt/qtlocation/qgeoserviceproviderfactoryv2.html
  • usr/share/doc/qt/qtlocation/qlocation.html
  • usr/share/doc/qt/qtlocation/qml-location5-maps.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapcircleobject-members.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapcircleobject.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapiconobject-members.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapiconobject.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapobjectview-members.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapobjectview.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mappolygonobject-members.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mappolygonobject.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mappolylineobject-members.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-mappolylineobject.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-maprouteobject-members.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-maprouteobject.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-navigator-members.html
  • usr/share/doc/qt/qtlocation/qml-qt-labs-location-navigator.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-cameracapabilities-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-cameracapabilities.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-category-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-category.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-categorymodel-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-categorymodel.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-contactdetail-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-contactdetail.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-contactdetails-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-contactdetails.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-dynamicparameter-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-dynamicparameter.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-editorialmodel-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-editorialmodel.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-extendedattributes-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-extendedattributes.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-geocodemodel-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-geocodemodel.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-icon-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-icon.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-imagemodel-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-imagemodel.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-map-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-map.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapcircle-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapcircle.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapcopyrightnotice-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapcopyrightnotice.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapgesturearea-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapgesturearea.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapitemgroup-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapitemgroup.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapitemview-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapitemview.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapparameter-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapparameter.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mappinchevent-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mappinchevent.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mappolygon-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mappolygon.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mappolyline-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mappolyline.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapquickitem-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-mapquickitem.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-maprectangle-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-maprectangle.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-maproute-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-maproute.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-maptype-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-maptype.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-place-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-place.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-placeattribute-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-placeattribute.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-placesearchmodel-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-placesearchmodel.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-placesearchsuggestionmodel-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-placesearchsuggestionmodel.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-plugin-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-plugin.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-pluginparameter-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-pluginparameter.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-ratings-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-ratings.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-reviewmodel-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-reviewmodel.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-route-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-route.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routeleg-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routeleg.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routemaneuver-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routemaneuver.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routemodel-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routemodel.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routequery-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routequery.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routesegment-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-routesegment.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-supplier-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-supplier.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-user-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-user.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-waypoint-members.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation-waypoint.html
  • usr/share/doc/qt/qtlocation/qml-qtlocation5-maps.html
  • usr/share/doc/qt/qtlocation/qplace-members.html
  • usr/share/doc/qt/qtlocation/qplace.html
  • usr/share/doc/qt/qtlocation/qplaceattribute-members.html
  • usr/share/doc/qt/qtlocation/qplaceattribute.html
  • usr/share/doc/qt/qtlocation/qplacecategory-members.html
  • usr/share/doc/qt/qtlocation/qplacecategory.html
  • usr/share/doc/qt/qtlocation/qplacecontactdetail-members.html
  • usr/share/doc/qt/qtlocation/qplacecontactdetail.html
  • usr/share/doc/qt/qtlocation/qplacecontent-members.html
  • usr/share/doc/qt/qtlocation/qplacecontent.html
  • usr/share/doc/qt/qtlocation/qplacecontentreply-members.html
  • usr/share/doc/qt/qtlocation/qplacecontentreply-obsolete.html
  • usr/share/doc/qt/qtlocation/qplacecontentreply.html
  • usr/share/doc/qt/qtlocation/qplacecontentrequest-members.html
  • usr/share/doc/qt/qtlocation/qplacecontentrequest.html
  • usr/share/doc/qt/qtlocation/qplacedetailsreply-members.html
  • usr/share/doc/qt/qtlocation/qplacedetailsreply-obsolete.html
  • usr/share/doc/qt/qtlocation/qplacedetailsreply.html
  • usr/share/doc/qt/qtlocation/qplaceeditorial-members.html
  • usr/share/doc/qt/qtlocation/qplaceeditorial.html
  • usr/share/doc/qt/qtlocation/qplaceicon-members.html
  • usr/share/doc/qt/qtlocation/qplaceicon.html
  • usr/share/doc/qt/qtlocation/qplaceidreply-members.html
  • usr/share/doc/qt/qtlocation/qplaceidreply-obsolete.html
  • usr/share/doc/qt/qtlocation/qplaceidreply.html
  • usr/share/doc/qt/qtlocation/qplaceimage-members.html
  • usr/share/doc/qt/qtlocation/qplaceimage.html
  • usr/share/doc/qt/qtlocation/qplacemanager-members.html
  • usr/share/doc/qt/qtlocation/qplacemanager-obsolete.html
  • usr/share/doc/qt/qtlocation/qplacemanager.html
  • usr/share/doc/qt/qtlocation/qplacemanagerengine-members.html
  • usr/share/doc/qt/qtlocation/qplacemanagerengine-obsolete.html
  • usr/share/doc/qt/qtlocation/qplacemanagerengine.html
  • usr/share/doc/qt/qtlocation/qplacematchreply-members.html
  • usr/share/doc/qt/qtlocation/qplacematchreply-obsolete.html
  • usr/share/doc/qt/qtlocation/qplacematchreply.html
  • usr/share/doc/qt/qtlocation/qplacematchrequest-members.html
  • usr/share/doc/qt/qtlocation/qplacematchrequest.html
  • usr/share/doc/qt/qtlocation/qplaceproposedsearchresult-members.html
  • usr/share/doc/qt/qtlocation/qplaceproposedsearchresult.html
  • usr/share/doc/qt/qtlocation/qplaceratings-members.html
  • usr/share/doc/qt/qtlocation/qplaceratings.html
  • usr/share/doc/qt/qtlocation/qplacereply-members.html
  • usr/share/doc/qt/qtlocation/qplacereply-obsolete.html
  • usr/share/doc/qt/qtlocation/qplacereply.html
  • usr/share/doc/qt/qtlocation/qplaceresult-members.html
  • usr/share/doc/qt/qtlocation/qplaceresult.html
  • usr/share/doc/qt/qtlocation/qplacereview-members.html
  • usr/share/doc/qt/qtlocation/qplacereview.html
  • usr/share/doc/qt/qtlocation/qplacesearchreply-members.html
  • usr/share/doc/qt/qtlocation/qplacesearchreply-obsolete.html
  • usr/share/doc/qt/qtlocation/qplacesearchreply.html
  • usr/share/doc/qt/qtlocation/qplacesearchrequest-members.html
  • usr/share/doc/qt/qtlocation/qplacesearchrequest.html
  • usr/share/doc/qt/qtlocation/qplacesearchresult-members.html
  • usr/share/doc/qt/qtlocation/qplacesearchresult.html
  • usr/share/doc/qt/qtlocation/qplacesearchsuggestionreply-members.html
  • usr/share/doc/qt/qtlocation/qplacesearchsuggestionreply-obsolete.html
  • usr/share/doc/qt/qtlocation/qplacesearchsuggestionreply.html
  • usr/share/doc/qt/qtlocation/qplacesupplier-members.html
  • usr/share/doc/qt/qtlocation/qplacesupplier.html
  • usr/share/doc/qt/qtlocation/qplaceuser-members.html
  • usr/share/doc/qt/qtlocation/qplaceuser.html
  • usr/share/doc/qt/qtlocation/qt-labs-location-qmlmodule.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-clip2tri.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-clipper.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-earcut.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-boost.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-css-color-parser.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-earcut.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-geojson.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-geojsonvt.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-geometry.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-kdbush.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-libcxx.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-nunicode.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-parsedate.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-polylabel.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-protozero.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-rapidjson.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-shelfpack.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-supercluster.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-tao-tuple.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-unique-resource.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-variant.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-vectortile.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-wagyu.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl.html
  • usr/share/doc/qt/qtlocation/qtlocation-attribution-poly2tri.html
  • usr/share/doc/qt/qtlocation/qtlocation-changes.html
  • usr/share/doc/qt/qtlocation/qtlocation-cpp.html
  • usr/share/doc/qt/qtlocation/qtlocation-examples.html
  • usr/share/doc/qt/qtlocation/qtlocation-geoservices.html
  • usr/share/doc/qt/qtlocation/qtlocation-index.html
  • usr/share/doc/qt/qtlocation/qtlocation-itemview-transitions-example.html
  • usr/share/doc/qt/qtlocation/qtlocation-itemview-transitions-itemview-transitions-pro.html
  • usr/share/doc/qt/qtlocation/qtlocation-itemview-transitions-main-cpp.html
  • usr/share/doc/qt/qtlocation/qtlocation-itemview-transitions-main-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-itemview-transitions-oslolistmodel-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-example.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-geocode-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-geocodeform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-locale-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-localeform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-message-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-messageform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-reversegeocode-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-reversegeocodeform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-routeaddress-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-routeaddressform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-routecoordinate-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-routecoordinateform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-routelist-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-routelistdelegate-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-forms-routelistheader-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-helper-js.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-main-cpp.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-circleitem-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-imageitem-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-mapcomponent-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-mapsliders-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-marker-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-minimap-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-polygonitem-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-polylineitem-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-map-rectangleitem-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-mapviewer-pro.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-mapviewer-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-mapviewer-qrc.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-menus-itempopupmenu-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-menus-mainmenu-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-menus-mappopupmenu-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-mapviewer-menus-markerpopupmenu-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-minimal-map-example.html
  • usr/share/doc/qt/qtlocation/qtlocation-minimal-map-main-cpp.html
  • usr/share/doc/qt/qtlocation/qtlocation-minimal-map-main-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-minimal-map-minimal-map-pro.html
  • usr/share/doc/qt/qtlocation/qtlocation-minimal-map-qml-qrc.html
  • usr/share/doc/qt/qtlocation/qtlocation-module.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-example.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-message-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-messageform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-placedetails-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-placedetailsform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-searchboundingbox-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-searchboundingboxform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-searchboundingcircle-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-searchboundingcircleform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-searchcenter-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-searchcenterform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-searchoptions-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-forms-searchoptionsform-ui-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-helper-js.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-items-mainmenu-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-items-mapcomponent-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-items-searchbar-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-list-example.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-list-main-cpp.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-list-marker-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-list-places-list-pro.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-list-places-list-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-list-places-list-qrc.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-main-cpp.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-map-example.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-map-main-cpp.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-map-places-map-pro.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-map-places-map-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-map-places-map-qrc.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-places-pro.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-places-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-places-qrc.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-categorydelegate-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-categoryview-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-editorialdelegate-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-editorialpage-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-editorialview-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-imageview-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-ratingview-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-reviewdelegate-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-reviewpage-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-reviewview-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-searchresultdelegate-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-searchresultview-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-places-views-suggestionview-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-planespotter-example.html
  • usr/share/doc/qt/qtlocation/qtlocation-planespotter-main-cpp.html
  • usr/share/doc/qt/qtlocation/qtlocation-planespotter-plane-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-planespotter-planespotter-pro.html
  • usr/share/doc/qt/qtlocation/qtlocation-planespotter-planespotter-qml.html
  • usr/share/doc/qt/qtlocation/qtlocation-planespotter-qml-qrc.html
  • usr/share/doc/qt/qtlocation/qtlocation-qmlmodule.html
  • usr/share/doc/qt/qtlocation/qtlocation.index
  • usr/share/doc/qt/qtlocation/qtlocation.qhp
  • usr/share/doc/qt/qtlocation/qtlocation.qhp.sha1
  • usr/share/doc/qt/qtlocation/qtlocation.tags
  • usr/share/doc/qt/qtlocation/style/
  • usr/share/doc/qt/qtlocation/style/offline-simple.css
  • usr/share/doc/qt/qtlocation/style/offline.css
  • usr/share/doc/qt/qtmacextras.qch
  • usr/share/doc/qt/qtmacextras/
  • usr/share/doc/qt/qtmacextras/examples-manifest.xml
  • usr/share/doc/qt/qtmacextras/examples-qtmacextras.html
  • usr/share/doc/qt/qtmacextras/images/
  • usr/share/doc/qt/qtmacextras/images/arrow_bc.png
  • usr/share/doc/qt/qtmacextras/images/bgrContent.png
  • usr/share/doc/qt/qtmacextras/images/btn_next.png
  • usr/share/doc/qt/qtmacextras/images/btn_prev.png
  • usr/share/doc/qt/qtmacextras/images/bullet_dn.png
  • usr/share/doc/qt/qtmacextras/images/bullet_sq.png
  • usr/share/doc/qt/qtmacextras/images/home.png
  • usr/share/doc/qt/qtmacextras/images/ico_note.png
  • usr/share/doc/qt/qtmacextras/images/ico_note_attention.png
  • usr/share/doc/qt/qtmacextras/images/ico_out.png
  • usr/share/doc/qt/qtmacextras/images/logo.png
  • usr/share/doc/qt/qtmacextras/images/used-in-examples/
  • usr/share/doc/qt/qtmacextras/images/used-in-examples/macfunctions/
  • usr/share/doc/qt/qtmacextras/images/used-in-examples/macfunctions/qtlogo.png
  • usr/share/doc/qt/qtmacextras/qmacpasteboardmime-members.html
  • usr/share/doc/qt/qtmacextras/qmacpasteboardmime.html
  • usr/share/doc/qt/qtmacextras/qmactoolbar-members.html
  • usr/share/doc/qt/qtmacextras/qmactoolbar-obsolete.html
  • usr/share/doc/qt/qtmacextras/qmactoolbar.html
  • usr/share/doc/qt/qtmacextras/qmactoolbaritem-members.html
  • usr/share/doc/qt/qtmacextras/qmactoolbaritem-obsolete.html
  • usr/share/doc/qt/qtmacextras/qmactoolbaritem.html
  • usr/share/doc/qt/qtmacextras/qtmac-obsolete.html
  • usr/share/doc/qt/qtmacextras/qtmac.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-embeddedqwindow-embeddedqwindow-pro.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-embeddedqwindow-example.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-embeddedqwindow-window-cpp.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-embeddedqwindow-window-h.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-index.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-macfunctions-example.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-macfunctions-macfunctions-pro.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-macfunctions-macfunctions-qrc.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-macfunctions-main-cpp.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-macpasteboardmime-example.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-macpasteboardmime-macpasteboardmime-pro.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-macpasteboardmime-main-cpp.html
  • usr/share/doc/qt/qtmacextras/qtmacextras-module.html
  • usr/share/doc/qt/qtmacextras/qtmacextras.index
  • usr/share/doc/qt/qtmacextras/qtmacextras.qhp
  • usr/share/doc/qt/qtmacextras/qtmacextras.qhp.sha1
  • usr/share/doc/qt/qtmacextras/style/
  • usr/share/doc/qt/qtmacextras/style/offline-simple.css
  • usr/share/doc/qt/qtmacextras/style/offline.css
  • usr/share/doc/qt/qtmultimedia.qch
  • usr/share/doc/qt/qtmultimedia/
  • usr/share/doc/qt/qtmultimedia/audiooverview.html
  • usr/share/doc/qt/qtmultimedia/cameraoverview.html
  • usr/share/doc/qt/qtmultimedia/changes.html
  • usr/share/doc/qt/qtmultimedia/examples-manifest.xml
  • usr/share/doc/qt/qtmultimedia/images/
  • usr/share/doc/qt/qtmultimedia/images/arrow_bc.png
  • usr/share/doc/qt/qtmultimedia/images/audiodevices.png
  • usr/share/doc/qt/qtmultimedia/images/audioinput-example.png
  • usr/share/doc/qt/qtmultimedia/images/audiooutput-example.png
  • usr/share/doc/qt/qtmultimedia/images/audiorecorder.png
  • usr/share/doc/qt/qtmultimedia/images/bgrContent.png
  • usr/share/doc/qt/qtmultimedia/images/btn_next.png
  • usr/share/doc/qt/qtmultimedia/images/btn_prev.png
  • usr/share/doc/qt/qtmultimedia/images/bullet_dn.png
  • usr/share/doc/qt/qtmultimedia/images/bullet_sq.png
  • usr/share/doc/qt/qtmultimedia/images/camera-example.png
  • usr/share/doc/qt/qtmultimedia/images/declarative-radio-example.png
  • usr/share/doc/qt/qtmultimedia/images/home.png
  • usr/share/doc/qt/qtmultimedia/images/ico_note.png
  • usr/share/doc/qt/qtmultimedia/images/ico_note_attention.png
  • usr/share/doc/qt/qtmultimedia/images/ico_out.png
  • usr/share/doc/qt/qtmultimedia/images/logo.png
  • usr/share/doc/qt/qtmultimedia/images/mediaplayerex.jpg
  • usr/share/doc/qt/qtmultimedia/images/qml-camera.png
  • usr/share/doc/qt/qtmultimedia/images/qmlvideo-menu.jpg
  • usr/share/doc/qt/qtmultimedia/images/qmlvideo-overlay.jpg
  • usr/share/doc/qt/qtmultimedia/images/qmlvideofx-camera-glow.jpg
  • usr/share/doc/qt/qtmultimedia/images/qmlvideofx-camera-wobble.jpg
  • usr/share/doc/qt/qtmultimedia/images/qmlvideofx-effects-menu.jpg
  • usr/share/doc/qt/qtmultimedia/images/qmlvideofx-video-edgedetection.jpg
  • usr/share/doc/qt/qtmultimedia/images/qmlvideofx-video-pagecurl.jpg
  • usr/share/doc/qt/qtmultimedia/images/radio-example.png
  • usr/share/doc/qt/qtmultimedia/images/spectrum-demo.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_auto_mode.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_camera_setting.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_auto.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_fill.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_off.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_redeye.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_cloudy.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_flourescent.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_incandescent.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_sunny.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/toolbutton.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/spectrum/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/spectrum/app/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/spectrum/app/images/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/spectrum/app/images/record.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/spectrum/app/images/settings.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/folder.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/leaves.jpg
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/up.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/qmlvideo.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Dropdown_arrows.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_bar.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_handle.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_Top.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_bottom.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_BackArrow.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Folder.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Menu.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/qt-logo.png
  • usr/share/doc/qt/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/qmlvideofx.png
  • usr/share/doc/qt/qtmultimedia/images/video-qml-paint-rate.png
  • usr/share/doc/qt/qtmultimedia/images/video-videographicsitem.png
  • usr/share/doc/qt/qtmultimedia/images/video-videowidget.png
  • usr/share/doc/qt/qtmultimedia/multimedia-examples.html
  • usr/share/doc/qt/qtmultimedia/multimediabackend.html
  • usr/share/doc/qt/qtmultimedia/multimediaoverview.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudiodeviceinfo-members.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudiodeviceinfo-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudiodeviceinfo.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudioinput-members.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudioinput-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudioinput.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudiooutput-members.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudiooutput-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qabstractaudiooutput.html
  • usr/share/doc/qt/qtmultimedia/qabstractplanarvideobuffer-members.html
  • usr/share/doc/qt/qtmultimedia/qabstractplanarvideobuffer.html
  • usr/share/doc/qt/qtmultimedia/qabstractvideobuffer-members.html
  • usr/share/doc/qt/qtmultimedia/qabstractvideobuffer.html
  • usr/share/doc/qt/qtmultimedia/qabstractvideofilter-members.html
  • usr/share/doc/qt/qtmultimedia/qabstractvideofilter-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qabstractvideofilter.html
  • usr/share/doc/qt/qtmultimedia/qabstractvideosurface-members.html
  • usr/share/doc/qt/qtmultimedia/qabstractvideosurface-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qabstractvideosurface.html
  • usr/share/doc/qt/qtmultimedia/qaudio.html
  • usr/share/doc/qt/qtmultimedia/qaudiobuffer-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiobuffer-stereoframe-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiobuffer-stereoframe.html
  • usr/share/doc/qt/qtmultimedia/qaudiobuffer.html
  • usr/share/doc/qt/qtmultimedia/qaudiodecoder-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiodecoder-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudiodecoder.html
  • usr/share/doc/qt/qtmultimedia/qaudiodecodercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiodecodercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudiodecodercontrol.html
  • usr/share/doc/qt/qtmultimedia/qaudiodeviceinfo-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiodeviceinfo.html
  • usr/share/doc/qt/qtmultimedia/qaudioencodersettings-members.html
  • usr/share/doc/qt/qtmultimedia/qaudioencodersettings.html
  • usr/share/doc/qt/qtmultimedia/qaudioencodersettingscontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qaudioencodersettingscontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudioencodersettingscontrol.html
  • usr/share/doc/qt/qtmultimedia/qaudioformat-members.html
  • usr/share/doc/qt/qtmultimedia/qaudioformat.html
  • usr/share/doc/qt/qtmultimedia/qaudioinput-members.html
  • usr/share/doc/qt/qtmultimedia/qaudioinput-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudioinput.html
  • usr/share/doc/qt/qtmultimedia/qaudioinputselectorcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qaudioinputselectorcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudioinputselectorcontrol.html
  • usr/share/doc/qt/qtmultimedia/qaudiooutput-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiooutput-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudiooutput.html
  • usr/share/doc/qt/qtmultimedia/qaudiooutputselectorcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiooutputselectorcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudiooutputselectorcontrol.html
  • usr/share/doc/qt/qtmultimedia/qaudioprobe-members.html
  • usr/share/doc/qt/qtmultimedia/qaudioprobe-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudioprobe.html
  • usr/share/doc/qt/qtmultimedia/qaudiorecorder-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiorecorder-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudiorecorder.html
  • usr/share/doc/qt/qtmultimedia/qaudiorolecontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiorolecontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudiorolecontrol.html
  • usr/share/doc/qt/qtmultimedia/qaudiosystemplugin-members.html
  • usr/share/doc/qt/qtmultimedia/qaudiosystemplugin-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qaudiosystemplugin.html
  • usr/share/doc/qt/qtmultimedia/qcamera-frameraterange-members.html
  • usr/share/doc/qt/qtmultimedia/qcamera-frameraterange.html
  • usr/share/doc/qt/qtmultimedia/qcamera-members.html
  • usr/share/doc/qt/qtmultimedia/qcamera-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcamera.html
  • usr/share/doc/qt/qtmultimedia/qcameracapturebufferformatcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameracapturebufferformatcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameracapturebufferformatcontrol.html
  • usr/share/doc/qt/qtmultimedia/qcameracapturedestinationcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameracapturedestinationcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameracapturedestinationcontrol.html
  • usr/share/doc/qt/qtmultimedia/qcameracontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameracontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameracontrol.html
  • usr/share/doc/qt/qtmultimedia/qcameraexposure-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraexposure-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraexposure.html
  • usr/share/doc/qt/qtmultimedia/qcameraexposurecontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraexposurecontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraexposurecontrol.html
  • usr/share/doc/qt/qtmultimedia/qcamerafeedbackcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcamerafeedbackcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcamerafeedbackcontrol.html
  • usr/share/doc/qt/qtmultimedia/qcameraflashcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraflashcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraflashcontrol.html
  • usr/share/doc/qt/qtmultimedia/qcamerafocus-members.html
  • usr/share/doc/qt/qtmultimedia/qcamerafocus-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcamerafocus.html
  • usr/share/doc/qt/qtmultimedia/qcamerafocuscontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcamerafocuscontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcamerafocuscontrol.html
  • usr/share/doc/qt/qtmultimedia/qcamerafocuszone-members.html
  • usr/share/doc/qt/qtmultimedia/qcamerafocuszone.html
  • usr/share/doc/qt/qtmultimedia/qcameraimagecapture-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraimagecapture-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraimagecapture.html
  • usr/share/doc/qt/qtmultimedia/qcameraimagecapturecontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraimagecapturecontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraimagecapturecontrol.html
  • usr/share/doc/qt/qtmultimedia/qcameraimageprocessing-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraimageprocessing-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraimageprocessing.html
  • usr/share/doc/qt/qtmultimedia/qcameraimageprocessingcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraimageprocessingcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraimageprocessingcontrol.html
  • usr/share/doc/qt/qtmultimedia/qcamerainfo-members.html
  • usr/share/doc/qt/qtmultimedia/qcamerainfo.html
  • usr/share/doc/qt/qtmultimedia/qcamerainfocontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcamerainfocontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcamerainfocontrol.html
  • usr/share/doc/qt/qtmultimedia/qcameralockscontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameralockscontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameralockscontrol.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfinder-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfinder-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfinder.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfindersettings-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfindersettings.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol2-members.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol2-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol2.html
  • usr/share/doc/qt/qtmultimedia/qcamerazoomcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcamerazoomcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcamerazoomcontrol.html
  • usr/share/doc/qt/qtmultimedia/qcustomaudiorolecontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qcustomaudiorolecontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qcustomaudiorolecontrol.html
  • usr/share/doc/qt/qtmultimedia/qgraphicsvideoitem-members.html
  • usr/share/doc/qt/qtmultimedia/qgraphicsvideoitem-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qgraphicsvideoitem.html
  • usr/share/doc/qt/qtmultimedia/qimageencodercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qimageencodercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qimageencodercontrol.html
  • usr/share/doc/qt/qtmultimedia/qimageencodersettings-members.html
  • usr/share/doc/qt/qtmultimedia/qimageencodersettings.html
  • usr/share/doc/qt/qtmultimedia/qmediaaudioprobecontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaaudioprobecontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediaaudioprobecontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediaavailabilitycontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaavailabilitycontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediaavailabilitycontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediabindableinterface-members.html
  • usr/share/doc/qt/qtmultimedia/qmediabindableinterface.html
  • usr/share/doc/qt/qtmultimedia/qmediacontainercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediacontainercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediacontainercontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediacontent-members.html
  • usr/share/doc/qt/qtmultimedia/qmediacontent.html
  • usr/share/doc/qt/qtmultimedia/qmediacontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediacontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediacontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediagaplessplaybackcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediagaplessplaybackcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediagaplessplaybackcontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediametadata.html
  • usr/share/doc/qt/qtmultimedia/qmedianetworkaccesscontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmedianetworkaccesscontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmedianetworkaccesscontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediaobject-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaobject-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediaobject.html
  • usr/share/doc/qt/qtmultimedia/qmediaplayer-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaplayer-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediaplayer.html
  • usr/share/doc/qt/qtmultimedia/qmediaplayercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaplayercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediaplayercontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediaplaylist-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaplaylist-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediaplaylist.html
  • usr/share/doc/qt/qtmultimedia/qmediarecorder-members.html
  • usr/share/doc/qt/qtmultimedia/qmediarecorder-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediarecorder.html
  • usr/share/doc/qt/qtmultimedia/qmediarecordercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediarecordercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediarecordercontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediaresource-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaresource.html
  • usr/share/doc/qt/qtmultimedia/qmediaservice-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaservice-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediaservice.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicecamerainfointerface-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicecamerainfointerface.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicedefaultdeviceinterface-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicedefaultdeviceinterface.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicefeaturesinterface-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicefeaturesinterface.html
  • usr/share/doc/qt/qtmultimedia/qmediaserviceproviderplugin-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaserviceproviderplugin-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediaserviceproviderplugin.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicesupporteddevicesinterface-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicesupporteddevicesinterface.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicesupportedformatsinterface-members.html
  • usr/share/doc/qt/qtmultimedia/qmediaservicesupportedformatsinterface.html
  • usr/share/doc/qt/qtmultimedia/qmediastreamscontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediastreamscontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediastreamscontrol.html
  • usr/share/doc/qt/qtmultimedia/qmediatimeinterval-members.html
  • usr/share/doc/qt/qtmultimedia/qmediatimeinterval.html
  • usr/share/doc/qt/qtmultimedia/qmediatimerange-members.html
  • usr/share/doc/qt/qtmultimedia/qmediatimerange.html
  • usr/share/doc/qt/qtmultimedia/qmediavideoprobecontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmediavideoprobecontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmediavideoprobecontrol.html
  • usr/share/doc/qt/qtmultimedia/qmetadatareadercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmetadatareadercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmetadatareadercontrol.html
  • usr/share/doc/qt/qtmultimedia/qmetadatawritercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qmetadatawritercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qmetadatawritercontrol.html
  • usr/share/doc/qt/qtmultimedia/qml-multimedia.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-attenuationmodellinear-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-attenuationmodellinear.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiocategory-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiocategory.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audioengine-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audioengine.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiolistener-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiolistener.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiosample-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiosample.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-playvariation-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-playvariation.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-sound-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-sound.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-soundinstance-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-soundinstance.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-audio-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-audio.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camera-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camera.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameracapture-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameracapture.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraexposure-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraexposure.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraflash-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraflash.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camerafocus-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camerafocus.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraimageprocessing-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraimageprocessing.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camerarecorder-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camerarecorder.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-mediaplayer-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-mediaplayer.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-playlist-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-playlist.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-playlistitem-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-playlistitem.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-qtmultimedia-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-qtmultimedia.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-radio-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-radio.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-radiodata-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-radiodata.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-soundeffect-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-soundeffect.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-torch-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-torch.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-video-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-video.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-videooutput-members.html
  • usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-videooutput.html
  • usr/share/doc/qt/qtmultimedia/qmultimedia.html
  • usr/share/doc/qt/qtmultimedia/qradiodata-members.html
  • usr/share/doc/qt/qtmultimedia/qradiodata-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qradiodata.html
  • usr/share/doc/qt/qtmultimedia/qradiodatacontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qradiodatacontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qradiodatacontrol.html
  • usr/share/doc/qt/qtmultimedia/qradiotuner-members.html
  • usr/share/doc/qt/qtmultimedia/qradiotuner-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qradiotuner.html
  • usr/share/doc/qt/qtmultimedia/qradiotunercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qradiotunercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qradiotunercontrol.html
  • usr/share/doc/qt/qtmultimedia/qsound-members.html
  • usr/share/doc/qt/qtmultimedia/qsound-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qsound.html
  • usr/share/doc/qt/qtmultimedia/qsoundeffect-members.html
  • usr/share/doc/qt/qtmultimedia/qsoundeffect-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qsoundeffect.html
  • usr/share/doc/qt/qtmultimedia/qtaudioengine-qmlmodule.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-index.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-ios.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-module.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-modules.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevicesbase-ui.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiodevices-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiodevices-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioengine-audioengine-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioengine-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qmlproject.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-content-myaudioengine-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioinput-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioinput-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiooutput-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiooutput-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiolevel-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiolevel-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-ui.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerabutton-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistbutton-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistpopup-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertybutton-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertypopup-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qmlproject.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qrc.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-focusbutton-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photocapturecontrols-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photopreview-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-popup-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-qmlcamera-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videocapturecontrols-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videopreview-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-zoomcontrol-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-radio-button-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-qrc.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-radio-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-radio-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-radio-view-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-array-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-def-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-dynarray-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlen-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlenparam-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassdirect-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassinverse-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealselect-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealusetrigo-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-oscsincos-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-def-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-fnc-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-int64-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-fnc-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-settings-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testaccuracy-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelperfixlen-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelpernormal-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testspeed-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testwhitenoisegen-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-app-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-qrc.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-spectrum-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-button-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerabasic-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradrag-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradummy-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreen-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreeninverted-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraitem-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameramove-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraoverlay-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraresize-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerarotate-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraspin-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-content-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-errordialog-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-filebrowser-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-main-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scene-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenebasic-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenedrag-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreen-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreeninverted-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemove-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemulti-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneoverlay-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneresize-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenerotate-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneselectionpanel-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenespin-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-seekcontrol-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videobasic-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodrag-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodummy-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofillmode-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreen-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreeninverted-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoitem-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videometadata-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videomove-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videooverlay-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoplaybackrate-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoresize-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videorotate-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoseek-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videospin-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-qrc.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-svg.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-trace-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-button-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-content-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentcamera-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentimage-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentvideo-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-curtain-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-divider-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effect-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectbillboard-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectblackandwhite-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectemboss-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectgaussianblur-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectglow-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectisolate-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectmagnify-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpagecurl-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpassthrough-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpixelate-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectposterize-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectripple-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectselectionlist-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsepia-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsharpen-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectshockwave-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsobeledgedetection1-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttiltshift-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttoon-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectvignette-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwarhol-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwobble-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-filebrowser-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-fileopen-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-hintedmousearea-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-main-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-parameterpanel-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-slider-qml.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-qrc.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-svg.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-trace-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-qrc.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-ui.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-images-shutter-svg.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-ui.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-ui.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-player-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-player-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-player-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videographicsitem-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-example.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-main-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-cpp.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-h.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videowidget-pro.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-qmlmodule.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia-windows.html
  • usr/share/doc/qt/qtmultimedia/qtmultimedia.index
  • usr/share/doc/qt/qtmultimedia/qtmultimedia.qhp
  • usr/share/doc/qt/qtmultimedia/qtmultimedia.qhp.sha1
  • usr/share/doc/qt/qtmultimedia/qtmultimediawidgets-index.html
  • usr/share/doc/qt/qtmultimedia/qtmultimediawidgets-module.html
  • usr/share/doc/qt/qtmultimedia/qvideodeviceselectorcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qvideodeviceselectorcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qvideodeviceselectorcontrol.html
  • usr/share/doc/qt/qtmultimedia/qvideoencodersettings-members.html
  • usr/share/doc/qt/qtmultimedia/qvideoencodersettings.html
  • usr/share/doc/qt/qtmultimedia/qvideoencodersettingscontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qvideoencodersettingscontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qvideoencodersettingscontrol.html
  • usr/share/doc/qt/qtmultimedia/qvideofilterrunnable-members.html
  • usr/share/doc/qt/qtmultimedia/qvideofilterrunnable.html
  • usr/share/doc/qt/qtmultimedia/qvideoframe-members.html
  • usr/share/doc/qt/qtmultimedia/qvideoframe.html
  • usr/share/doc/qt/qtmultimedia/qvideoprobe-members.html
  • usr/share/doc/qt/qtmultimedia/qvideoprobe-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qvideoprobe.html
  • usr/share/doc/qt/qtmultimedia/qvideorenderercontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qvideorenderercontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qvideorenderercontrol.html
  • usr/share/doc/qt/qtmultimedia/qvideosurfaceformat-members.html
  • usr/share/doc/qt/qtmultimedia/qvideosurfaceformat.html
  • usr/share/doc/qt/qtmultimedia/qvideowidget-members.html
  • usr/share/doc/qt/qtmultimedia/qvideowidget-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qvideowidget.html
  • usr/share/doc/qt/qtmultimedia/qvideowidgetcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qvideowidgetcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qvideowidgetcontrol.html
  • usr/share/doc/qt/qtmultimedia/qvideowindowcontrol-members.html
  • usr/share/doc/qt/qtmultimedia/qvideowindowcontrol-obsolete.html
  • usr/share/doc/qt/qtmultimedia/qvideowindowcontrol.html
  • usr/share/doc/qt/qtmultimedia/radiooverview.html
  • usr/share/doc/qt/qtmultimedia/style/
  • usr/share/doc/qt/qtmultimedia/style/offline-simple.css
  • usr/share/doc/qt/qtmultimedia/style/offline.css
  • usr/share/doc/qt/qtmultimedia/videooverview.html
  • usr/share/doc/qt/qtnetwork.qch
  • usr/share/doc/qt/qtnetwork/
  • usr/share/doc/qt/qtnetwork/bearer-management.html
  • usr/share/doc/qt/qtnetwork/examples-manifest.xml
  • usr/share/doc/qt/qtnetwork/examples-network.html
  • usr/share/doc/qt/qtnetwork/images/
  • usr/share/doc/qt/qtnetwork/images/arrow_bc.png
  • usr/share/doc/qt/qtnetwork/images/bgrContent.png
  • usr/share/doc/qt/qtnetwork/images/blockingfortuneclient-example.png
  • usr/share/doc/qt/qtnetwork/images/broadcastreceiver-example.png
  • usr/share/doc/qt/qtnetwork/images/broadcastsender-example.png
  • usr/share/doc/qt/qtnetwork/images/btn_next.png
  • usr/share/doc/qt/qtnetwork/images/btn_prev.png
  • usr/share/doc/qt/qtnetwork/images/bullet_dn.png
  • usr/share/doc/qt/qtnetwork/images/bullet_sq.png
  • usr/share/doc/qt/qtnetwork/images/fortuneclient-example.png
  • usr/share/doc/qt/qtnetwork/images/fortuneserver-example.png
  • usr/share/doc/qt/qtnetwork/images/googlesuggest-example.png
  • usr/share/doc/qt/qtnetwork/images/home.png
  • usr/share/doc/qt/qtnetwork/images/http-example.png
  • usr/share/doc/qt/qtnetwork/images/ico_note.png
  • usr/share/doc/qt/qtnetwork/images/ico_note_attention.png
  • usr/share/doc/qt/qtnetwork/images/ico_out.png
  • usr/share/doc/qt/qtnetwork/images/logo.png
  • usr/share/doc/qt/qtnetwork/images/loopback-example.png
  • usr/share/doc/qt/qtnetwork/images/multicastreceiver-example.png
  • usr/share/doc/qt/qtnetwork/images/multicastsender-example.png
  • usr/share/doc/qt/qtnetwork/images/network-chat-example.png
  • usr/share/doc/qt/qtnetwork/images/network-examples.png
  • usr/share/doc/qt/qtnetwork/images/roaming-states.png
  • usr/share/doc/qt/qtnetwork/images/securesocketclient.png
  • usr/share/doc/qt/qtnetwork/images/securesocketclient2.png
  • usr/share/doc/qt/qtnetwork/images/secureudpclient-example.png
  • usr/share/doc/qt/qtnetwork/images/secureudpserver-example.png
  • usr/share/doc/qt/qtnetwork/images/tcpstream.png
  • usr/share/doc/qt/qtnetwork/images/threadedfortuneserver-example.png
  • usr/share/doc/qt/qtnetwork/images/torrent-example.png
  • usr/share/doc/qt/qtnetwork/images/udppackets.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/securesocketclient/
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/securesocketclient/encrypted.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/1downarrow.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/1uparrow.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/bottom.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/edit_add.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/edit_remove.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/exit.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/peertopeer.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/player_pause.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/player_play.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/player_stop.png
  • usr/share/doc/qt/qtnetwork/images/used-in-examples/torrent/icons/stop.png
  • usr/share/doc/qt/qtnetwork/network.html
  • usr/share/doc/qt/qtnetwork/qabstractnetworkcache-members.html
  • usr/share/doc/qt/qtnetwork/qabstractnetworkcache-obsolete.html
  • usr/share/doc/qt/qtnetwork/qabstractnetworkcache.html
  • usr/share/doc/qt/qtnetwork/qabstractsocket-members.html
  • usr/share/doc/qt/qtnetwork/qabstractsocket-obsolete.html
  • usr/share/doc/qt/qtnetwork/qabstractsocket.html
  • usr/share/doc/qt/qtnetwork/qauthenticator-members.html
  • usr/share/doc/qt/qtnetwork/qauthenticator.html
  • usr/share/doc/qt/qtnetwork/qdnsdomainnamerecord-members.html
  • usr/share/doc/qt/qtnetwork/qdnsdomainnamerecord.html
  • usr/share/doc/qt/qtnetwork/qdnshostaddressrecord-members.html
  • usr/share/doc/qt/qtnetwork/qdnshostaddressrecord.html
  • usr/share/doc/qt/qtnetwork/qdnslookup-members.html
  • usr/share/doc/qt/qtnetwork/qdnslookup-obsolete.html
  • usr/share/doc/qt/qtnetwork/qdnslookup.html
  • usr/share/doc/qt/qtnetwork/qdnsmailexchangerecord-members.html
  • usr/share/doc/qt/qtnetwork/qdnsmailexchangerecord.html
  • usr/share/doc/qt/qtnetwork/qdnsservicerecord-members.html
  • usr/share/doc/qt/qtnetwork/qdnsservicerecord.html
  • usr/share/doc/qt/qtnetwork/qdnstextrecord-members.html
  • usr/share/doc/qt/qtnetwork/qdnstextrecord.html
  • usr/share/doc/qt/qtnetwork/qdtls-members.html
  • usr/share/doc/qt/qtnetwork/qdtls-obsolete.html
  • usr/share/doc/qt/qtnetwork/qdtls.html
  • usr/share/doc/qt/qtnetwork/qdtlsclientverifier-generatorparameters-members.html
  • usr/share/doc/qt/qtnetwork/qdtlsclientverifier-generatorparameters.html
  • usr/share/doc/qt/qtnetwork/qdtlsclientverifier-members.html
  • usr/share/doc/qt/qtnetwork/qdtlsclientverifier-obsolete.html
  • usr/share/doc/qt/qtnetwork/qdtlsclientverifier.html
  • usr/share/doc/qt/qtnetwork/qhostaddress-members.html
  • usr/share/doc/qt/qtnetwork/qhostaddress.html
  • usr/share/doc/qt/qtnetwork/qhostinfo-members.html
  • usr/share/doc/qt/qtnetwork/qhostinfo.html
  • usr/share/doc/qt/qtnetwork/qhstspolicy-members.html
  • usr/share/doc/qt/qtnetwork/qhstspolicy.html
  • usr/share/doc/qt/qtnetwork/qhttpmultipart-members.html
  • usr/share/doc/qt/qtnetwork/qhttpmultipart-obsolete.html
  • usr/share/doc/qt/qtnetwork/qhttpmultipart.html
  • usr/share/doc/qt/qtnetwork/qhttppart-members.html
  • usr/share/doc/qt/qtnetwork/qhttppart.html
  • usr/share/doc/qt/qtnetwork/qlocalserver-members.html
  • usr/share/doc/qt/qtnetwork/qlocalserver-obsolete.html
  • usr/share/doc/qt/qtnetwork/qlocalserver.html
  • usr/share/doc/qt/qtnetwork/qlocalsocket-members.html
  • usr/share/doc/qt/qtnetwork/qlocalsocket-obsolete.html
  • usr/share/doc/qt/qtnetwork/qlocalsocket.html
  • usr/share/doc/qt/qtnetwork/qnetworkaccessmanager-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkaccessmanager-obsolete.html
  • usr/share/doc/qt/qtnetwork/qnetworkaccessmanager.html
  • usr/share/doc/qt/qtnetwork/qnetworkaddressentry-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkaddressentry.html
  • usr/share/doc/qt/qtnetwork/qnetworkcachemetadata-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkcachemetadata.html
  • usr/share/doc/qt/qtnetwork/qnetworkconfiguration-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkconfiguration.html
  • usr/share/doc/qt/qtnetwork/qnetworkconfigurationmanager-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkconfigurationmanager-obsolete.html
  • usr/share/doc/qt/qtnetwork/qnetworkconfigurationmanager.html
  • usr/share/doc/qt/qtnetwork/qnetworkcookie-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkcookie.html
  • usr/share/doc/qt/qtnetwork/qnetworkcookiejar-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkcookiejar-obsolete.html
  • usr/share/doc/qt/qtnetwork/qnetworkcookiejar.html
  • usr/share/doc/qt/qtnetwork/qnetworkdatagram-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkdatagram.html
  • usr/share/doc/qt/qtnetwork/qnetworkdiskcache-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkdiskcache-obsolete.html
  • usr/share/doc/qt/qtnetwork/qnetworkdiskcache.html
  • usr/share/doc/qt/qtnetwork/qnetworkinterface-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkinterface.html
  • usr/share/doc/qt/qtnetwork/qnetworkproxy-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkproxy.html
  • usr/share/doc/qt/qtnetwork/qnetworkproxyfactory-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkproxyfactory.html
  • usr/share/doc/qt/qtnetwork/qnetworkproxyquery-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkproxyquery-obsolete.html
  • usr/share/doc/qt/qtnetwork/qnetworkproxyquery.html
  • usr/share/doc/qt/qtnetwork/qnetworkreply-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkreply-obsolete.html
  • usr/share/doc/qt/qtnetwork/qnetworkreply.html
  • usr/share/doc/qt/qtnetwork/qnetworkrequest-members.html
  • usr/share/doc/qt/qtnetwork/qnetworkrequest.html
  • usr/share/doc/qt/qtnetwork/qnetworksession-members.html
  • usr/share/doc/qt/qtnetwork/qnetworksession-obsolete.html
  • usr/share/doc/qt/qtnetwork/qnetworksession.html
  • usr/share/doc/qt/qtnetwork/qpassworddigestor.html
  • usr/share/doc/qt/qtnetwork/qsctpserver-members.html
  • usr/share/doc/qt/qtnetwork/qsctpserver-obsolete.html
  • usr/share/doc/qt/qtnetwork/qsctpserver.html
  • usr/share/doc/qt/qtnetwork/qsctpsocket-members.html
  • usr/share/doc/qt/qtnetwork/qsctpsocket-obsolete.html
  • usr/share/doc/qt/qtnetwork/qsctpsocket.html
  • usr/share/doc/qt/qtnetwork/qssl-obsolete.html
  • usr/share/doc/qt/qtnetwork/qssl.html
  • usr/share/doc/qt/qtnetwork/qsslcertificate-members.html
  • usr/share/doc/qt/qtnetwork/qsslcertificate.html
  • usr/share/doc/qt/qtnetwork/qsslcertificateextension-members.html
  • usr/share/doc/qt/qtnetwork/qsslcertificateextension.html
  • usr/share/doc/qt/qtnetwork/qsslcipher-members.html
  • usr/share/doc/qt/qtnetwork/qsslcipher.html
  • usr/share/doc/qt/qtnetwork/qsslconfiguration-members.html
  • usr/share/doc/qt/qtnetwork/qsslconfiguration.html
  • usr/share/doc/qt/qtnetwork/qssldiffiehellmanparameters-members.html
  • usr/share/doc/qt/qtnetwork/qssldiffiehellmanparameters.html
  • usr/share/doc/qt/qtnetwork/qsslellipticcurve-members.html
  • usr/share/doc/qt/qtnetwork/qsslellipticcurve.html
  • usr/share/doc/qt/qtnetwork/qsslerror-members.html
  • usr/share/doc/qt/qtnetwork/qsslerror.html
  • usr/share/doc/qt/qtnetwork/qsslkey-members.html
  • usr/share/doc/qt/qtnetwork/qsslkey.html
  • usr/share/doc/qt/qtnetwork/qsslpresharedkeyauthenticator-members.html
  • usr/share/doc/qt/qtnetwork/qsslpresharedkeyauthenticator.html
  • usr/share/doc/qt/qtnetwork/qsslsocket-members.html
  • usr/share/doc/qt/qtnetwork/qsslsocket-obsolete.html
  • usr/share/doc/qt/qtnetwork/qsslsocket.html
  • usr/share/doc/qt/qtnetwork/qtcpserver-members.html
  • usr/share/doc/qt/qtnetwork/qtcpserver-obsolete.html
  • usr/share/doc/qt/qtnetwork/qtcpserver.html
  • usr/share/doc/qt/qtnetwork/qtcpsocket-members.html
  • usr/share/doc/qt/qtnetwork/qtcpsocket-obsolete.html
  • usr/share/doc/qt/qtnetwork/qtcpsocket.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-blockingfortuneclient-blockingfortuneclient-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-blockingfortuneclient-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-blockingfortuneclient-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastreceiver-broadcastreceiver-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastreceiver-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastreceiver-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastreceiver-receiver-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastreceiver-receiver-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastsender-broadcastsender-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastsender-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastsender-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastsender-sender-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-broadcastsender-sender-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-download-download-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-download-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-download-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-downloadmanager-downloadmanager-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-downloadmanager-downloadmanager-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-downloadmanager-downloadmanager-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-downloadmanager-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-downloadmanager-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-downloadmanager-textprogressbar-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-downloadmanager-textprogressbar-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneclient-client-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneclient-client-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneclient-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneclient-fortuneclient-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneclient-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneserver-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneserver-fortuneserver-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneserver-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneserver-server-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-fortuneserver-server-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-googlesuggest-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-googlesuggest-googlesuggest-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-googlesuggest-googlesuggest-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-googlesuggest-googlesuggest-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-googlesuggest-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-googlesuggest-searchbox-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-googlesuggest-searchbox-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-http-authenticationdialog-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-http-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-http-http-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-http-httpwindow-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-http-httpwindow-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-http-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-index.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-loopback-dialog-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-loopback-dialog-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-loopback-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-loopback-loopback-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-loopback-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-module.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastreceiver-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastreceiver-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastreceiver-multicastreceiver-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastreceiver-receiver-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastreceiver-receiver-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastsender-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastsender-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastsender-multicastsender-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastsender-sender-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-multicastsender-sender-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-chatdialog-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-chatdialog-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-chatdialog-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-client-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-client-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-connection-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-connection-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-network-chat-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-peermanager-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-peermanager-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-server-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-server-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-programming.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-certificateinfo-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-certificateinfo-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-certificateinfo-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-securesocketclient-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-securesocketclient-qrc.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-sslclient-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-sslclient-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-sslclient-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-sslerrors-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-addressdialog-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-addressdialog-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-addressdialog-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-association-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-association-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-mainwindow-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-mainwindow-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-mainwindow-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-secureudpclient-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-mainwindow-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-mainwindow-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-mainwindow-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-nicselector-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-nicselector-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-nicselector-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-secureudpserver-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-server-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-server-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-dialog-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-dialog-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-threadedfortuneserver-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-addtorrentdialog-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-addtorrentdialog-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-bencodeparser-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-bencodeparser-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-connectionmanager-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-connectionmanager-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-example.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-filemanager-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-filemanager-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-forms-addtorrentform-ui.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-icons-qrc.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-main-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-mainwindow-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-mainwindow-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-metainfo-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-metainfo-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-peerwireclient-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-peerwireclient-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-ratecontroller-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-ratecontroller-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-torrent-pro.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-torrentclient-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-torrentclient-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-torrentserver-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-torrentserver-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-trackerclient-cpp.html
  • usr/share/doc/qt/qtnetwork/qtnetwork-torrent-trackerclient-h.html
  • usr/share/doc/qt/qtnetwork/qtnetwork.index
  • usr/share/doc/qt/qtnetwork/qtnetwork.qhp
  • usr/share/doc/qt/qtnetwork/qtnetwork.qhp.sha1
  • usr/share/doc/qt/qtnetwork/qtnetwork.tags
  • usr/share/doc/qt/qtnetwork/qudpsocket-members.html
  • usr/share/doc/qt/qtnetwork/qudpsocket-obsolete.html
  • usr/share/doc/qt/qtnetwork/qudpsocket.html
  • usr/share/doc/qt/qtnetwork/ssl.html
  • usr/share/doc/qt/qtnetwork/style/
  • usr/share/doc/qt/qtnetwork/style/offline-simple.css
  • usr/share/doc/qt/qtnetwork/style/offline.css
  • usr/share/doc/qt/qtnetworkauth.qch
  • usr/share/doc/qt/qtnetworkauth/
  • usr/share/doc/qt/qtnetworkauth/examples-manifest.xml
  • usr/share/doc/qt/qtnetworkauth/examples-qtnetworkauth.html
  • usr/share/doc/qt/qtnetworkauth/images/
  • usr/share/doc/qt/qtnetworkauth/images/arrow_bc.png
  • usr/share/doc/qt/qtnetworkauth/images/bgrContent.png
  • usr/share/doc/qt/qtnetworkauth/images/btn_next.png
  • usr/share/doc/qt/qtnetworkauth/images/btn_prev.png
  • usr/share/doc/qt/qtnetworkauth/images/bullet_dn.png
  • usr/share/doc/qt/qtnetworkauth/images/bullet_sq.png
  • usr/share/doc/qt/qtnetworkauth/images/home.png
  • usr/share/doc/qt/qtnetworkauth/images/ico_note.png
  • usr/share/doc/qt/qtnetworkauth/images/ico_note_attention.png
  • usr/share/doc/qt/qtnetworkauth/images/ico_out.png
  • usr/share/doc/qt/qtnetworkauth/images/logo.png
  • usr/share/doc/qt/qtnetworkauth/images/redditclient-example.png
  • usr/share/doc/qt/qtnetworkauth/images/twittertimeline-example.png
  • usr/share/doc/qt/qtnetworkauth/qabstractoauth-members.html
  • usr/share/doc/qt/qtnetworkauth/qabstractoauth-obsolete.html
  • usr/share/doc/qt/qtnetworkauth/qabstractoauth.html
  • usr/share/doc/qt/qtnetworkauth/qabstractoauth2-members.html
  • usr/share/doc/qt/qtnetworkauth/qabstractoauth2-obsolete.html
  • usr/share/doc/qt/qtnetworkauth/qabstractoauth2.html
  • usr/share/doc/qt/qtnetworkauth/qabstractoauthreplyhandler-members.html
  • usr/share/doc/qt/qtnetworkauth/qabstractoauthreplyhandler-obsolete.html
  • usr/share/doc/qt/qtnetworkauth/qabstractoauthreplyhandler.html
  • usr/share/doc/qt/qtnetworkauth/qoauth1-members.html
  • usr/share/doc/qt/qtnetworkauth/qoauth1-obsolete.html
  • usr/share/doc/qt/qtnetworkauth/qoauth1.html
  • usr/share/doc/qt/qtnetworkauth/qoauth1signature-members.html
  • usr/share/doc/qt/qtnetworkauth/qoauth1signature.html
  • usr/share/doc/qt/qtnetworkauth/qoauth2authorizationcodeflow-members.html
  • usr/share/doc/qt/qtnetworkauth/qoauth2authorizationcodeflow-obsolete.html
  • usr/share/doc/qt/qtnetworkauth/qoauth2authorizationcodeflow.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-index.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-module.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-redditclient-example.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-redditclient-main-cpp.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-redditclient-redditclient-pro.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-redditclient-redditmodel-cpp.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-redditclient-redditmodel-h.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-redditclient-redditwrapper-cpp.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-redditclient-redditwrapper-h.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-example.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-main-cpp.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-twitter-cpp.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-twitter-h.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-twitterdialog-ui.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-twittertimeline-pro.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-twittertimelinemodel-cpp.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-twittertimelinemodel-h.html
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth.index
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth.qhp
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth.qhp.sha1
  • usr/share/doc/qt/qtnetworkauth/qtnetworkauth.tags
  • usr/share/doc/qt/qtnetworkauth/style/
  • usr/share/doc/qt/qtnetworkauth/style/offline-simple.css
  • usr/share/doc/qt/qtnetworkauth/style/offline.css
  • usr/share/doc/qt/qtnfc.qch
  • usr/share/doc/qt/qtnfc/
  • usr/share/doc/qt/qtnfc/examples-manifest.xml
  • usr/share/doc/qt/qtnfc/images/
  • usr/share/doc/qt/qtnfc/images/annotatedurl.png
  • usr/share/doc/qt/qtnfc/images/annotatedurl2.png
  • usr/share/doc/qt/qtnfc/images/arrow_bc.png
  • usr/share/doc/qt/qtnfc/images/bgrContent.png
  • usr/share/doc/qt/qtnfc/images/btn_next.png
  • usr/share/doc/qt/qtnfc/images/btn_prev.png
  • usr/share/doc/qt/qtnfc/images/bullet_dn.png
  • usr/share/doc/qt/qtnfc/images/bullet_sq.png
  • usr/share/doc/qt/qtnfc/images/corkboard.png
  • usr/share/doc/qt/qtnfc/images/home.png
  • usr/share/doc/qt/qtnfc/images/ico_note.png
  • usr/share/doc/qt/qtnfc/images/ico_note_attention.png
  • usr/share/doc/qt/qtnfc/images/ico_out.png
  • usr/share/doc/qt/qtnfc/images/logo.png
  • usr/share/doc/qt/qtnfc/images/ndefeditor.png
  • usr/share/doc/qt/qtnfc/images/qml-poster-example.png
  • usr/share/doc/qt/qtnfc/images/used-in-examples/
  • usr/share/doc/qt/qtnfc/images/used-in-examples/corkboard/
  • usr/share/doc/qt/qtnfc/images/used-in-examples/corkboard/NfcFlag.png
  • usr/share/doc/qt/qtnfc/images/used-in-examples/corkboard/cork.jpg
  • usr/share/doc/qt/qtnfc/images/used-in-examples/corkboard/icon.png
  • usr/share/doc/qt/qtnfc/images/used-in-examples/corkboard/note-yellow.png
  • usr/share/doc/qt/qtnfc/images/used-in-examples/corkboard/tack.png
  • usr/share/doc/qt/qtnfc/nfc-android.html
  • usr/share/doc/qt/qtnfc/nfc-examples.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndeffilter-members.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndeffilter.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndefmimerecord-members.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndefmimerecord.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndefrecord-members.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndefrecord.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndeftextrecord-members.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndeftextrecord.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndefurirecord-members.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-ndefurirecord.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-nearfield-members.html
  • usr/share/doc/qt/qtnfc/qml-qtnfc-nearfield.html
  • usr/share/doc/qt/qtnfc/qndeffilter-members.html
  • usr/share/doc/qt/qtnfc/qndeffilter-record-members.html
  • usr/share/doc/qt/qtnfc/qndeffilter-record.html
  • usr/share/doc/qt/qtnfc/qndeffilter.html
  • usr/share/doc/qt/qtnfc/qndefmessage-members.html
  • usr/share/doc/qt/qtnfc/qndefmessage.html
  • usr/share/doc/qt/qtnfc/qndefnfcsmartposterrecord-members.html
  • usr/share/doc/qt/qtnfc/qndefnfcsmartposterrecord.html
  • usr/share/doc/qt/qtnfc/qndefnfctextrecord-members.html
  • usr/share/doc/qt/qtnfc/qndefnfctextrecord.html
  • usr/share/doc/qt/qtnfc/qndefnfcurirecord-members.html
  • usr/share/doc/qt/qtnfc/qndefnfcurirecord.html
  • usr/share/doc/qt/qtnfc/qndefrecord-members.html
  • usr/share/doc/qt/qtnfc/qndefrecord.html
  • usr/share/doc/qt/qtnfc/qnearfieldmanager-members.html
  • usr/share/doc/qt/qtnfc/qnearfieldmanager-obsolete.html
  • usr/share/doc/qt/qtnfc/qnearfieldmanager.html
  • usr/share/doc/qt/qtnfc/qnearfieldsharemanager-members.html
  • usr/share/doc/qt/qtnfc/qnearfieldsharemanager-obsolete.html
  • usr/share/doc/qt/qtnfc/qnearfieldsharemanager.html
  • usr/share/doc/qt/qtnfc/qnearfieldsharetarget-members.html
  • usr/share/doc/qt/qtnfc/qnearfieldsharetarget-obsolete.html
  • usr/share/doc/qt/qtnfc/qnearfieldsharetarget.html
  • usr/share/doc/qt/qtnfc/qnearfieldtarget-members.html
  • usr/share/doc/qt/qtnfc/qnearfieldtarget-obsolete.html
  • usr/share/doc/qt/qtnfc/qnearfieldtarget-requestid-members.html
  • usr/share/doc/qt/qtnfc/qnearfieldtarget-requestid.html
  • usr/share/doc/qt/qtnfc/qnearfieldtarget-requestidprivate-members.html
  • usr/share/doc/qt/qtnfc/qnearfieldtarget-requestidprivate.html
  • usr/share/doc/qt/qtnfc/qnearfieldtarget.html
  • usr/share/doc/qt/qtnfc/qqmlndefrecord-members.html
  • usr/share/doc/qt/qtnfc/qqmlndefrecord-obsolete.html
  • usr/share/doc/qt/qtnfc/qqmlndefrecord.html
  • usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-annotatedurl-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-annotatedurl-h.html
  • usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-annotatedurl-pro.html
  • usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-example.html
  • usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-main-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-mainwindow-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-mainwindow-h.html
  • usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-mainwindow-ui.html
  • usr/share/doc/qt/qtnfc/qtnfc-corkboard-android-androidmanifest-xml.html
  • usr/share/doc/qt/qtnfc/qtnfc-corkboard-corkboard-pro.html
  • usr/share/doc/qt/qtnfc/qtnfc-corkboard-corkboard-qrc.html
  • usr/share/doc/qt/qtnfc/qtnfc-corkboard-corkboards-qml.html
  • usr/share/doc/qt/qtnfc/qtnfc-corkboard-example.html
  • usr/share/doc/qt/qtnfc/qtnfc-corkboard-main-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-corkboard-mode-qml.html
  • usr/share/doc/qt/qtnfc/qtnfc-index.html
  • usr/share/doc/qt/qtnfc/qtnfc-module.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-example.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-main-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-mainwindow-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-mainwindow-h.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-mainwindow-ui.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-h.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-ui.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-ndefeditor-pro.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-textrecordeditor-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-textrecordeditor-h.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-textrecordeditor-ui.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-urirecordeditor-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-urirecordeditor-h.html
  • usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-urirecordeditor-ui.html
  • usr/share/doc/qt/qtnfc/qtnfc-overview.html
  • usr/share/doc/qt/qtnfc/qtnfc-poster-example.html
  • usr/share/doc/qt/qtnfc/qtnfc-poster-poster-pro.html
  • usr/share/doc/qt/qtnfc/qtnfc-poster-poster-qml.html
  • usr/share/doc/qt/qtnfc/qtnfc-poster-poster-qrc.html
  • usr/share/doc/qt/qtnfc/qtnfc-poster-qmlposter-cpp.html
  • usr/share/doc/qt/qtnfc/qtnfc-qmlmodule.html
  • usr/share/doc/qt/qtnfc/qtnfc.index
  • usr/share/doc/qt/qtnfc/qtnfc.qhp
  • usr/share/doc/qt/qtnfc/qtnfc.qhp.sha1
  • usr/share/doc/qt/qtnfc/qtnfc.tags
  • usr/share/doc/qt/qtnfc/style/
  • usr/share/doc/qt/qtnfc/style/offline-simple.css
  • usr/share/doc/qt/qtnfc/style/offline.css
  • usr/share/doc/qt/qtopengl.qch
  • usr/share/doc/qt/qtopengl/
  • usr/share/doc/qt/qtopengl/examples-manifest.xml
  • usr/share/doc/qt/qtopengl/examples-widgets-opengl.html
  • usr/share/doc/qt/qtopengl/images/
  • usr/share/doc/qt/qtopengl/images/2dpainting-example.png
  • usr/share/doc/qt/qtopengl/images/arrow_bc.png
  • usr/share/doc/qt/qtopengl/images/bgrContent.png
  • usr/share/doc/qt/qtopengl/images/btn_next.png
  • usr/share/doc/qt/qtopengl/images/btn_prev.png
  • usr/share/doc/qt/qtopengl/images/bullet_dn.png
  • usr/share/doc/qt/qtopengl/images/bullet_sq.png
  • usr/share/doc/qt/qtopengl/images/cube.png
  • usr/share/doc/qt/qtopengl/images/cube_faces.png
  • usr/share/doc/qt/qtopengl/images/hellogl2-example.png
  • usr/share/doc/qt/qtopengl/images/hellogles3-example.png
  • usr/share/doc/qt/qtopengl/images/home.png
  • usr/share/doc/qt/qtopengl/images/ico_note.png
  • usr/share/doc/qt/qtopengl/images/ico_note_attention.png
  • usr/share/doc/qt/qtopengl/images/ico_out.png
  • usr/share/doc/qt/qtopengl/images/logo.png
  • usr/share/doc/qt/qtopengl/images/opengl-examples.png
  • usr/share/doc/qt/qtopengl/images/textures-example.png
  • usr/share/doc/qt/qtopengl/images/used-in-examples/
  • usr/share/doc/qt/qtopengl/images/used-in-examples/cube/
  • usr/share/doc/qt/qtopengl/images/used-in-examples/cube/cube.png
  • usr/share/doc/qt/qtopengl/images/used-in-examples/hellogles3/
  • usr/share/doc/qt/qtopengl/images/used-in-examples/hellogles3/qtlogo.png
  • usr/share/doc/qt/qtopengl/images/used-in-examples/textures/
  • usr/share/doc/qt/qtopengl/images/used-in-examples/textures/images/
  • usr/share/doc/qt/qtopengl/images/used-in-examples/textures/images/side1.png
  • usr/share/doc/qt/qtopengl/images/used-in-examples/textures/images/side2.png
  • usr/share/doc/qt/qtopengl/images/used-in-examples/textures/images/side3.png
  • usr/share/doc/qt/qtopengl/images/used-in-examples/textures/images/side4.png
  • usr/share/doc/qt/qtopengl/images/used-in-examples/textures/images/side5.png
  • usr/share/doc/qt/qtopengl/images/used-in-examples/textures/images/side6.png
  • usr/share/doc/qt/qtopengl/qgl.html
  • usr/share/doc/qt/qtopengl/qglbuffer-members.html
  • usr/share/doc/qt/qtopengl/qglbuffer.html
  • usr/share/doc/qt/qtopengl/qglcolormap-members.html
  • usr/share/doc/qt/qtopengl/qglcolormap.html
  • usr/share/doc/qt/qtopengl/qglcontext-members.html
  • usr/share/doc/qt/qtopengl/qglcontext-obsolete.html
  • usr/share/doc/qt/qtopengl/qglcontext.html
  • usr/share/doc/qt/qtopengl/qglformat-members.html
  • usr/share/doc/qt/qtopengl/qglformat.html
  • usr/share/doc/qt/qtopengl/qglframebufferobject-members.html
  • usr/share/doc/qt/qtopengl/qglframebufferobject.html
  • usr/share/doc/qt/qtopengl/qglframebufferobjectformat-members.html
  • usr/share/doc/qt/qtopengl/qglframebufferobjectformat.html
  • usr/share/doc/qt/qtopengl/qglfunctions-members.html
  • usr/share/doc/qt/qtopengl/qglfunctions.html
  • usr/share/doc/qt/qtopengl/qglpixelbuffer-members.html
  • usr/share/doc/qt/qtopengl/qglpixelbuffer.html
  • usr/share/doc/qt/qtopengl/qglshader-members.html
  • usr/share/doc/qt/qtopengl/qglshader-obsolete.html
  • usr/share/doc/qt/qtopengl/qglshader.html
  • usr/share/doc/qt/qtopengl/qglshaderprogram-members.html
  • usr/share/doc/qt/qtopengl/qglshaderprogram-obsolete.html
  • usr/share/doc/qt/qtopengl/qglshaderprogram.html
  • usr/share/doc/qt/qtopengl/qglwidget-members.html
  • usr/share/doc/qt/qtopengl/qglwidget-obsolete.html
  • usr/share/doc/qt/qtopengl/qglwidget.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-2dpainting-pro.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-example.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-glwidget-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-glwidget-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-helper-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-helper-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-main-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-widget-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-widget-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-window-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-2dpainting-window-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-cube-pro.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-example.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-fshader-glsl.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-geometryengine-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-geometryengine-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-main-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-mainwidget-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-mainwidget-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-shaders-qrc.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-textures-qrc.html
  • usr/share/doc/qt/qtopengl/qtopengl-cube-vshader-glsl.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-example.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-glwidget-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-glwidget-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-hellogl2-pro.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-logo-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-logo-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-main-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-mainwindow-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-mainwindow-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-window-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogl2-window-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogles3-example.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogles3-glwindow-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogles3-glwindow-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogles3-hellogles3-pro.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogles3-hellogles3-qrc.html
  • usr/share/doc/qt/qtopengl/qtopengl-hellogles3-main-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-index.html
  • usr/share/doc/qt/qtopengl/qtopengl-module.html
  • usr/share/doc/qt/qtopengl/qtopengl-textures-example.html
  • usr/share/doc/qt/qtopengl/qtopengl-textures-glwidget-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-textures-glwidget-h.html
  • usr/share/doc/qt/qtopengl/qtopengl-textures-main-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-textures-textures-pro.html
  • usr/share/doc/qt/qtopengl/qtopengl-textures-textures-qrc.html
  • usr/share/doc/qt/qtopengl/qtopengl-textures-window-cpp.html
  • usr/share/doc/qt/qtopengl/qtopengl-textures-window-h.html
  • usr/share/doc/qt/qtopengl/qtopengl.index
  • usr/share/doc/qt/qtopengl/qtopengl.qhp
  • usr/share/doc/qt/qtopengl/qtopengl.qhp.sha1
  • usr/share/doc/qt/qtopengl/style/
  • usr/share/doc/qt/qtopengl/style/offline-simple.css
  • usr/share/doc/qt/qtopengl/style/offline.css
  • usr/share/doc/qt/qtplatformheaders.qch
  • usr/share/doc/qt/qtplatformheaders/
  • usr/share/doc/qt/qtplatformheaders/images/
  • usr/share/doc/qt/qtplatformheaders/images/arrow_bc.png
  • usr/share/doc/qt/qtplatformheaders/images/bgrContent.png
  • usr/share/doc/qt/qtplatformheaders/images/btn_next.png
  • usr/share/doc/qt/qtplatformheaders/images/btn_prev.png
  • usr/share/doc/qt/qtplatformheaders/images/bullet_dn.png
  • usr/share/doc/qt/qtplatformheaders/images/bullet_sq.png
  • usr/share/doc/qt/qtplatformheaders/images/home.png
  • usr/share/doc/qt/qtplatformheaders/images/ico_note.png
  • usr/share/doc/qt/qtplatformheaders/images/ico_note_attention.png
  • usr/share/doc/qt/qtplatformheaders/images/ico_out.png
  • usr/share/doc/qt/qtplatformheaders/images/logo.png
  • usr/share/doc/qt/qtplatformheaders/qtplatformheaders-index.html
  • usr/share/doc/qt/qtplatformheaders/qtplatformheaders-module.html
  • usr/share/doc/qt/qtplatformheaders/qtplatformheaders.index
  • usr/share/doc/qt/qtplatformheaders/qtplatformheaders.qhp
  • usr/share/doc/qt/qtplatformheaders/qtplatformheaders.qhp.sha1
  • usr/share/doc/qt/qtplatformheaders/style/
  • usr/share/doc/qt/qtplatformheaders/style/offline-simple.css
  • usr/share/doc/qt/qtplatformheaders/style/offline.css
  • usr/share/doc/qt/qtpositioning.qch
  • usr/share/doc/qt/qtpositioning/
  • usr/share/doc/qt/qtpositioning/examples-manifest.xml
  • usr/share/doc/qt/qtpositioning/images/
  • usr/share/doc/qt/qtpositioning/images/arrow_bc.png
  • usr/share/doc/qt/qtpositioning/images/bgrContent.png
  • usr/share/doc/qt/qtpositioning/images/btn_next.png
  • usr/share/doc/qt/qtpositioning/images/btn_prev.png
  • usr/share/doc/qt/qtpositioning/images/bullet_dn.png
  • usr/share/doc/qt/qtpositioning/images/bullet_sq.png
  • usr/share/doc/qt/qtpositioning/images/example-satelliteinfo.png
  • usr/share/doc/qt/qtpositioning/images/example-weatherinfo.png
  • usr/share/doc/qt/qtpositioning/images/home.png
  • usr/share/doc/qt/qtpositioning/images/ico_note.png
  • usr/share/doc/qt/qtpositioning/images/ico_note_attention.png
  • usr/share/doc/qt/qtpositioning/images/ico_out.png
  • usr/share/doc/qt/qtpositioning/images/logo.png
  • usr/share/doc/qt/qtpositioning/images/qml-flickr-1.jpg
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/gloss.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/lineedit.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/moon.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/quit.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/star.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/stripes.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/sun.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/titlebar.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/toolbutton.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-few-clouds.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-fog.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-haze.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-icy.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-overcast.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-showers.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sleet.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-snow.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-storm.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sunny-very-few-clouds.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sunny.png
  • usr/share/doc/qt/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-thundershower.png
  • usr/share/doc/qt/qtpositioning/location-positioning-cpp.html
  • usr/share/doc/qt/qtpositioning/location-positioning-qml.html
  • usr/share/doc/qt/qtpositioning/positioning-cpp-qml.html
  • usr/share/doc/qt/qtpositioning/qgeoaddress-members.html
  • usr/share/doc/qt/qtpositioning/qgeoaddress.html
  • usr/share/doc/qt/qtpositioning/qgeoareamonitorinfo-members.html
  • usr/share/doc/qt/qtpositioning/qgeoareamonitorinfo.html
  • usr/share/doc/qt/qtpositioning/qgeoareamonitorsource-members.html
  • usr/share/doc/qt/qtpositioning/qgeoareamonitorsource-obsolete.html
  • usr/share/doc/qt/qtpositioning/qgeoareamonitorsource.html
  • usr/share/doc/qt/qtpositioning/qgeocircle-members.html
  • usr/share/doc/qt/qtpositioning/qgeocircle-obsolete.html
  • usr/share/doc/qt/qtpositioning/qgeocircle.html
  • usr/share/doc/qt/qtpositioning/qgeocoordinate-members.html
  • usr/share/doc/qt/qtpositioning/qgeocoordinate.html
  • usr/share/doc/qt/qtpositioning/qgeolocation-members.html
  • usr/share/doc/qt/qtpositioning/qgeolocation.html
  • usr/share/doc/qt/qtpositioning/qgeopath-members.html
  • usr/share/doc/qt/qtpositioning/qgeopath-obsolete.html
  • usr/share/doc/qt/qtpositioning/qgeopath.html
  • usr/share/doc/qt/qtpositioning/qgeopolygon-members.html
  • usr/share/doc/qt/qtpositioning/qgeopolygon-obsolete.html
  • usr/share/doc/qt/qtpositioning/qgeopolygon.html
  • usr/share/doc/qt/qtpositioning/qgeopositioninfo-members.html
  • usr/share/doc/qt/qtpositioning/qgeopositioninfo.html
  • usr/share/doc/qt/qtpositioning/qgeopositioninfosource-members.html
  • usr/share/doc/qt/qtpositioning/qgeopositioninfosource-obsolete.html
  • usr/share/doc/qt/qtpositioning/qgeopositioninfosource.html
  • usr/share/doc/qt/qtpositioning/qgeopositioninfosourcefactory-members.html
  • usr/share/doc/qt/qtpositioning/qgeopositioninfosourcefactory.html
  • usr/share/doc/qt/qtpositioning/qgeorectangle-members.html
  • usr/share/doc/qt/qtpositioning/qgeorectangle-obsolete.html
  • usr/share/doc/qt/qtpositioning/qgeorectangle.html
  • usr/share/doc/qt/qtpositioning/qgeosatelliteinfo-members.html
  • usr/share/doc/qt/qtpositioning/qgeosatelliteinfo.html
  • usr/share/doc/qt/qtpositioning/qgeosatelliteinfosource-members.html
  • usr/share/doc/qt/qtpositioning/qgeosatelliteinfosource-obsolete.html
  • usr/share/doc/qt/qtpositioning/qgeosatelliteinfosource.html
  • usr/share/doc/qt/qtpositioning/qgeoshape-members.html
  • usr/share/doc/qt/qtpositioning/qgeoshape-obsolete.html
  • usr/share/doc/qt/qtpositioning/qgeoshape.html
  • usr/share/doc/qt/qtpositioning/qml-coordinate.html
  • usr/share/doc/qt/qtpositioning/qml-geocircle.html
  • usr/share/doc/qt/qtpositioning/qml-geopath.html
  • usr/share/doc/qt/qtpositioning/qml-geopolygon.html
  • usr/share/doc/qt/qtpositioning/qml-georectangle.html
  • usr/share/doc/qt/qtpositioning/qml-geoshape.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-address-members.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-address.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-coordinateanimation-members.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-coordinateanimation.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-location-members.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-location.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-position-members.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-position.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-positionsource-members.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-positionsource.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-qtpositioning-members.html
  • usr/share/doc/qt/qtpositioning/qml-qtpositioning-qtpositioning.html
  • usr/share/doc/qt/qtpositioning/qnmeapositioninfosource-members.html
  • usr/share/doc/qt/qtpositioning/qnmeapositioninfosource-obsolete.html
  • usr/share/doc/qt/qtpositioning/qnmeapositioninfosource.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-attribution-weatherinfo-tango-icons.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-attribution-weatherinfo-tango-weather-pack.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-examples.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-example.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickr-90-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickr-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickr-qrc.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrcommon-progress-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrcommon-restmodel-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrcommon-scrollbar-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrcommon-slider-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrmobile-button-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrmobile-geotab-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrmobile-griddelegate-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrmobile-imagedetails-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrmobile-listdelegate-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrmobile-titlebar-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-flickrmobile-toolbar-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-geoflickr-pro.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-geoflickr-qmlproject.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-qmllocationflickr-cpp.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-index.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-cpp.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-h.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-example.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-logfile-qrc.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-cpp.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-h.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-pro.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-main-cpp.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-module.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-plugins.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-qmlmodule.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-satelliteinfo-example.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-satelliteinfo-main-cpp.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-pro.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qrc.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-cpp.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-h.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-appmodel-cpp.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-appmodel-h.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-components-bigforecasticon-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-components-forecasticon-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-components-weathericon-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-example.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-main-cpp.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-weatherinfo-pro.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qml.html
  • usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qrc.html
  • usr/share/doc/qt/qtpositioning/qtpositioning.index
  • usr/share/doc/qt/qtpositioning/qtpositioning.qhp
  • usr/share/doc/qt/qtpositioning/qtpositioning.qhp.sha1
  • usr/share/doc/qt/qtpositioning/qtpositioning.tags
  • usr/share/doc/qt/qtpositioning/style/
  • usr/share/doc/qt/qtpositioning/style/offline-simple.css
  • usr/share/doc/qt/qtpositioning/style/offline.css
  • usr/share/doc/qt/qtprintsupport.qch
  • usr/share/doc/qt/qtprintsupport/
  • usr/share/doc/qt/qtprintsupport/images/
  • usr/share/doc/qt/qtprintsupport/images/arrow_bc.png
  • usr/share/doc/qt/qtprintsupport/images/bgrContent.png
  • usr/share/doc/qt/qtprintsupport/images/btn_next.png
  • usr/share/doc/qt/qtprintsupport/images/btn_prev.png
  • usr/share/doc/qt/qtprintsupport/images/bullet_dn.png
  • usr/share/doc/qt/qtprintsupport/images/bullet_sq.png
  • usr/share/doc/qt/qtprintsupport/images/home.png
  • usr/share/doc/qt/qtprintsupport/images/ico_note.png
  • usr/share/doc/qt/qtprintsupport/images/ico_note_attention.png
  • usr/share/doc/qt/qtprintsupport/images/ico_out.png
  • usr/share/doc/qt/qtprintsupport/images/logo.png
  • usr/share/doc/qt/qtprintsupport/images/plastique-printdialog-properties.png
  • usr/share/doc/qt/qtprintsupport/images/plastique-printdialog.png
  • usr/share/doc/qt/qtprintsupport/images/printer-rects.png
  • usr/share/doc/qt/qtprintsupport/pdf-licensing.html
  • usr/share/doc/qt/qtprintsupport/printing.html
  • usr/share/doc/qt/qtprintsupport/qabstractprintdialog-members.html
  • usr/share/doc/qt/qtprintsupport/qabstractprintdialog-obsolete.html
  • usr/share/doc/qt/qtprintsupport/qabstractprintdialog.html
  • usr/share/doc/qt/qtprintsupport/qpagesetupdialog-members.html
  • usr/share/doc/qt/qtprintsupport/qpagesetupdialog-obsolete.html
  • usr/share/doc/qt/qtprintsupport/qpagesetupdialog.html
  • usr/share/doc/qt/qtprintsupport/qprintdialog-members.html
  • usr/share/doc/qt/qtprintsupport/qprintdialog-obsolete.html
  • usr/share/doc/qt/qtprintsupport/qprintdialog.html
  • usr/share/doc/qt/qtprintsupport/qprintengine-members.html
  • usr/share/doc/qt/qtprintsupport/qprintengine.html
  • usr/share/doc/qt/qtprintsupport/qprinter-members.html
  • usr/share/doc/qt/qtprintsupport/qprinter-obsolete.html
  • usr/share/doc/qt/qtprintsupport/qprinter.html
  • usr/share/doc/qt/qtprintsupport/qprinterinfo-members.html
  • usr/share/doc/qt/qtprintsupport/qprinterinfo-obsolete.html
  • usr/share/doc/qt/qtprintsupport/qprinterinfo.html
  • usr/share/doc/qt/qtprintsupport/qprintpreviewdialog-members.html
  • usr/share/doc/qt/qtprintsupport/qprintpreviewdialog-obsolete.html
  • usr/share/doc/qt/qtprintsupport/qprintpreviewdialog.html
  • usr/share/doc/qt/qtprintsupport/qprintpreviewwidget-members.html
  • usr/share/doc/qt/qtprintsupport/qprintpreviewwidget-obsolete.html
  • usr/share/doc/qt/qtprintsupport/qprintpreviewwidget.html
  • usr/share/doc/qt/qtprintsupport/qtprintsupport-index.html
  • usr/share/doc/qt/qtprintsupport/qtprintsupport-module.html
  • usr/share/doc/qt/qtprintsupport/qtprintsupport.index
  • usr/share/doc/qt/qtprintsupport/qtprintsupport.qhp
  • usr/share/doc/qt/qtprintsupport/qtprintsupport.qhp.sha1
  • usr/share/doc/qt/qtprintsupport/qtprintsupport.tags
  • usr/share/doc/qt/qtprintsupport/style/
  • usr/share/doc/qt/qtprintsupport/style/offline-simple.css
  • usr/share/doc/qt/qtprintsupport/style/offline.css
  • usr/share/doc/qt/qtpurchasing.qch
  • usr/share/doc/qt/qtpurchasing/
  • usr/share/doc/qt/qtpurchasing/examples-manifest.xml
  • usr/share/doc/qt/qtpurchasing/images/
  • usr/share/doc/qt/qtpurchasing/images/arrow_bc.png
  • usr/share/doc/qt/qtpurchasing/images/bgrContent.png
  • usr/share/doc/qt/qtpurchasing/images/btn_next.png
  • usr/share/doc/qt/qtpurchasing/images/btn_prev.png
  • usr/share/doc/qt/qtpurchasing/images/bullet_dn.png
  • usr/share/doc/qt/qtpurchasing/images/bullet_sq.png
  • usr/share/doc/qt/qtpurchasing/images/home.png
  • usr/share/doc/qt/qtpurchasing/images/ico_note.png
  • usr/share/doc/qt/qtpurchasing/images/ico_note_attention.png
  • usr/share/doc/qt/qtpurchasing/images/ico_out.png
  • usr/share/doc/qt/qtpurchasing/images/logo.png
  • usr/share/doc/qt/qtpurchasing/images/qthangman-example.png
  • usr/share/doc/qt/qtpurchasing/images/qthangman-store-example.png
  • usr/share/doc/qt/qtpurchasing/qinappproduct-members.html
  • usr/share/doc/qt/qtpurchasing/qinappproduct-obsolete.html
  • usr/share/doc/qt/qtpurchasing/qinappproduct.html
  • usr/share/doc/qt/qtpurchasing/qinappstore-members.html
  • usr/share/doc/qt/qtpurchasing/qinappstore-obsolete.html
  • usr/share/doc/qt/qtpurchasing/qinappstore.html
  • usr/share/doc/qt/qtpurchasing/qinapptransaction-members.html
  • usr/share/doc/qt/qtpurchasing/qinapptransaction-obsolete.html
  • usr/share/doc/qt/qtpurchasing/qinapptransaction.html
  • usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-product-members.html
  • usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-product.html
  • usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-store-members.html
  • usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-store.html
  • usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-transaction-members.html
  • usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-transaction.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-appstore.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-attribution-base64decoder.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-attribution-inappservice.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-attribution-pkeyverify.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-examples.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-gettingstarted-cpp.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-gettingstarted-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-googleplay.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-index.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-module.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qmlmodule.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-example.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-hangmangame-cpp.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-hangmangame-h.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-main-cpp.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-gameview-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-guesswordview-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-hangman-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-howtoview-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-key-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-letter-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-letterselector-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-main-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-mainview-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-pageheader-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-qmldir.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-scoreitem-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-settings-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-simplebutton-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-splashscreen-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-storeitem-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-storeview-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-windows-settings-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-word-qml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-qthangman-pro.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-resources-qrc.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-winrt-qtstoresimulation-xml.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-winrt-winrt-qrc.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing-windowsstore.html
  • usr/share/doc/qt/qtpurchasing/qtpurchasing.index
  • usr/share/doc/qt/qtpurchasing/qtpurchasing.qhp
  • usr/share/doc/qt/qtpurchasing/qtpurchasing.qhp.sha1
  • usr/share/doc/qt/qtpurchasing/style/
  • usr/share/doc/qt/qtpurchasing/style/offline-simple.css
  • usr/share/doc/qt/qtpurchasing/style/offline.css
  • usr/share/doc/qt/qtqml.qch
  • usr/share/doc/qt/qtqml/
  • usr/share/doc/qt/qtqml/examples-manifest.xml
  • usr/share/doc/qt/qtqml/images/
  • usr/share/doc/qt/qtqml/images/arrow_bc.png
  • usr/share/doc/qt/qtqml/images/bgrContent.png
  • usr/share/doc/qt/qtqml/images/btn_next.png
  • usr/share/doc/qt/qtqml/images/btn_prev.png
  • usr/share/doc/qt/qtqml/images/bullet_dn.png
  • usr/share/doc/qt/qtqml/images/bullet_sq.png
  • usr/share/doc/qt/qtqml/images/button-types.png
  • usr/share/doc/qt/qtqml/images/cpp-qml-integration-flowchart.png
  • usr/share/doc/qt/qtqml/images/cppintegration-ex.png
  • usr/share/doc/qt/qtqml/images/declarative-rect_tint.png
  • usr/share/doc/qt/qtqml/images/documents-definetypes-attributes.png
  • usr/share/doc/qt/qtqml/images/documents-definetypes-simple.png
  • usr/share/doc/qt/qtqml/images/extending-tutorial-chapter1.png
  • usr/share/doc/qt/qtqml/images/extending-tutorial-chapter2.png
  • usr/share/doc/qt/qtqml/images/extending-tutorial-chapter3.png
  • usr/share/doc/qt/qtqml/images/extending-tutorial-chapter5.png
  • usr/share/doc/qt/qtqml/images/home.png
  • usr/share/doc/qt/qtqml/images/ico_note.png
  • usr/share/doc/qt/qtqml/images/ico_note_attention.png
  • usr/share/doc/qt/qtqml/images/ico_out.png
  • usr/share/doc/qt/qtqml/images/listmodel-nested.png
  • usr/share/doc/qt/qtqml/images/listmodel.png
  • usr/share/doc/qt/qtqml/images/logo.png
  • usr/share/doc/qt/qtqml/images/objectmodel.png
  • usr/share/doc/qt/qtqml/images/qml-dynamicscene-example.png
  • usr/share/doc/qt/qtqml/images/qml-i18n-example.png
  • usr/share/doc/qt/qtqml/images/qml-plugins-example.png
  • usr/share/doc/qt/qtqml/images/qml-xmlhttprequest-example.png
  • usr/share/doc/qt/qtqml/images/qtqml-syntax-basics-object-declaration.png
  • usr/share/doc/qt/qtqml/images/statemachine-button-history.png
  • usr/share/doc/qt/qtqml/images/statemachine-button-nested.png
  • usr/share/doc/qt/qtqml/images/statemachine-button.png
  • usr/share/doc/qt/qtqml/images/statemachine-finished.png
  • usr/share/doc/qt/qtqml/images/statemachine-nonparallel.png
  • usr/share/doc/qt/qtqml/images/statemachine-parallel.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/images/
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/images/face-smile.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/images/moon.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/images/rabbit_brown.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/images/rabbit_bw.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/images/star.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/images/sun.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/dynamicscene/content/images/tree_s.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/qmlextensionplugins/
  • usr/share/doc/qt/qtqml/images/used-in-examples/qmlextensionplugins/imports/
  • usr/share/doc/qt/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/
  • usr/share/doc/qt/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/center.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/clock.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/hour.png
  • usr/share/doc/qt/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/minute.png
  • usr/share/doc/qt/qtqml/qjsengine-members.html
  • usr/share/doc/qt/qtqml/qjsengine-obsolete.html
  • usr/share/doc/qt/qtqml/qjsengine.html
  • usr/share/doc/qt/qtqml/qjsvalue-members.html
  • usr/share/doc/qt/qtqml/qjsvalue-obsolete.html
  • usr/share/doc/qt/qtqml/qjsvalue.html
  • usr/share/doc/qt/qtqml/qjsvalueiterator-members.html
  • usr/share/doc/qt/qtqml/qjsvalueiterator.html
  • usr/share/doc/qt/qtqml/qml-bool.html
  • usr/share/doc/qt/qtqml/qml-date.html
  • usr/share/doc/qt/qtqml/qml-double.html
  • usr/share/doc/qt/qtqml/qml-enumeration.html
  • usr/share/doc/qt/qtqml/qml-int.html
  • usr/share/doc/qt/qtqml/qml-list.html
  • usr/share/doc/qt/qtqml/qml-package-members.html
  • usr/share/doc/qt/qtqml/qml-package.html
  • usr/share/doc/qt/qtqml/qml-point.html
  • usr/share/doc/qt/qtqml/qml-qt-labs-qmlmodels-delegatechoice-members.html
  • usr/share/doc/qt/qtqml/qml-qt-labs-qmlmodels-delegatechoice.html
  • usr/share/doc/qt/qtqml/qml-qt-labs-qmlmodels-delegatechooser-members.html
  • usr/share/doc/qt/qtqml/qml-qt-labs-qmlmodels-delegatechooser.html
  • usr/share/doc/qt/qtqml/qml-qtqml-binding-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-binding.html
  • usr/share/doc/qt/qtqml/qml-qtqml-component-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-component.html
  • usr/share/doc/qt/qtqml/qml-qtqml-connections-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-connections.html
  • usr/share/doc/qt/qtqml/qml-qtqml-date-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-date.html
  • usr/share/doc/qt/qtqml/qml-qtqml-instantiator-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-instantiator.html
  • usr/share/doc/qt/qtqml/qml-qtqml-locale-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-locale.html
  • usr/share/doc/qt/qtqml/qml-qtqml-loggingcategory-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-loggingcategory.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-delegatemodel-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-delegatemodel.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-delegatemodelgroup-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-delegatemodelgroup.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-itemselectionmodel-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-itemselectionmodel.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-listelement-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-listelement.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-listmodel-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-listmodel.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-objectmodel-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-models-objectmodel.html
  • usr/share/doc/qt/qtqml/qml-qtqml-number-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-number.html
  • usr/share/doc/qt/qtqml/qml-qtqml-qt-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-qt.html
  • usr/share/doc/qt/qtqml/qml-qtqml-qtobject-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-qtobject.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-finalstate-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-finalstate.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-historystate-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-historystate.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qabstractstate-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qabstractstate.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qabstracttransition-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qabstracttransition.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qsignaltransition-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qsignaltransition.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-signaltransition-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-signaltransition.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-state-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-state.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-statemachine-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-statemachine.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-timeouttransition-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-statemachine-timeouttransition.html
  • usr/share/doc/qt/qtqml/qml-qtqml-string-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-string.html
  • usr/share/doc/qt/qtqml/qml-qtqml-timer-members.html
  • usr/share/doc/qt/qtqml/qml-qtqml-timer.html
  • usr/share/doc/qt/qtqml/qml-real.html
  • usr/share/doc/qt/qtqml/qml-rect.html
  • usr/share/doc/qt/qtqml/qml-size.html
  • usr/share/doc/qt/qtqml/qml-string.html
  • usr/share/doc/qt/qtqml/qml-url.html
  • usr/share/doc/qt/qtqml/qml-var.html
  • usr/share/doc/qt/qtqml/qml-variant.html
  • usr/share/doc/qt/qtqml/qml-workerscript-members.html
  • usr/share/doc/qt/qtqml/qml-workerscript.html
  • usr/share/doc/qt/qtqml/qmlextendingexamples.html
  • usr/share/doc/qt/qtqml/qmlreference.html
  • usr/share/doc/qt/qtqml/qmlstatemachine.html
  • usr/share/doc/qt/qtqml/qmodelindex-and-related-classes-in-qml.html
  • usr/share/doc/qt/qtqml/qqmlabstracturlinterceptor-members.html
  • usr/share/doc/qt/qtqml/qqmlabstracturlinterceptor.html
  • usr/share/doc/qt/qtqml/qqmlapplicationengine-members.html
  • usr/share/doc/qt/qtqml/qqmlapplicationengine-obsolete.html
  • usr/share/doc/qt/qtqml/qqmlapplicationengine.html
  • usr/share/doc/qt/qtqml/qqmlcomponent-members.html
  • usr/share/doc/qt/qtqml/qqmlcomponent-obsolete.html
  • usr/share/doc/qt/qtqml/qqmlcomponent.html
  • usr/share/doc/qt/qtqml/qqmlcontext-members.html
  • usr/share/doc/qt/qtqml/qqmlcontext-obsolete.html
  • usr/share/doc/qt/qtqml/qqmlcontext-propertypair-members.html
  • usr/share/doc/qt/qtqml/qqmlcontext-propertypair.html
  • usr/share/doc/qt/qtqml/qqmlcontext.html
  • usr/share/doc/qt/qtqml/qqmlengine-members.html
  • usr/share/doc/qt/qtqml/qqmlengine-obsolete.html
  • usr/share/doc/qt/qtqml/qqmlengine.html
  • usr/share/doc/qt/qtqml/qqmlerror-members.html
  • usr/share/doc/qt/qtqml/qqmlerror.html
  • usr/share/doc/qt/qtqml/qqmlexpression-members.html
  • usr/share/doc/qt/qtqml/qqmlexpression-obsolete.html
  • usr/share/doc/qt/qtqml/qqmlexpression.html
  • usr/share/doc/qt/qtqml/qqmlextensionplugin-members.html
  • usr/share/doc/qt/qtqml/qqmlextensionplugin-obsolete.html
  • usr/share/doc/qt/qtqml/qqmlextensionplugin.html
  • usr/share/doc/qt/qtqml/qqmlfileselector-members.html
  • usr/share/doc/qt/qtqml/qqmlfileselector-obsolete.html
  • usr/share/doc/qt/qtqml/qqmlfileselector.html
  • usr/share/doc/qt/qtqml/qqmlimageproviderbase-members.html
  • usr/share/doc/qt/qtqml/qqmlimageproviderbase.html
  • usr/share/doc/qt/qtqml/qqmlincubationcontroller-members.html
  • usr/share/doc/qt/qtqml/qqmlincubationcontroller.html
  • usr/share/doc/qt/qtqml/qqmlincubator-members.html
  • usr/share/doc/qt/qtqml/qqmlincubator.html
  • usr/share/doc/qt/qtqml/qqmllistproperty-members.html
  • usr/share/doc/qt/qtqml/qqmllistproperty.html
  • usr/share/doc/qt/qtqml/qqmllistreference-members.html
  • usr/share/doc/qt/qtqml/qqmllistreference.html
  • usr/share/doc/qt/qtqml/qqmlnetworkaccessmanagerfactory-members.html
  • usr/share/doc/qt/qtqml/qqmlnetworkaccessmanagerfactory.html
  • usr/share/doc/qt/qtqml/qqmlparserstatus-members.html
  • usr/share/doc/qt/qtqml/qqmlparserstatus.html
  • usr/share/doc/qt/qtqml/qqmlproperty-members.html
  • usr/share/doc/qt/qtqml/qqmlproperty.html
  • usr/share/doc/qt/qtqml/qqmlpropertymap-members.html
  • usr/share/doc/qt/qtqml/qqmlpropertymap-obsolete.html
  • usr/share/doc/qt/qtqml/qqmlpropertymap.html
  • usr/share/doc/qt/qtqml/qqmlpropertyvaluesource-members.html
  • usr/share/doc/qt/qtqml/qqmlpropertyvaluesource.html
  • usr/share/doc/qt/qtqml/qqmlscriptstring-members.html
  • usr/share/doc/qt/qtqml/qqmlscriptstring.html
  • usr/share/doc/qt/qtqml/qt-labs-qmlmodels-qmlmodule.html
  • usr/share/doc/qt/qtqml/qtjavascript.html
  • usr/share/doc/qt/qtqml/qtqml-attribution-masm.html
  • usr/share/doc/qt/qtqml/qtqml-cppclasses-topic.html
  • usr/share/doc/qt/qtqml/qtqml-cppintegration-contextproperties.html
  • usr/share/doc/qt/qtqml/qtqml-cppintegration-data.html
  • usr/share/doc/qt/qtqml/qtqml-cppintegration-definetypes.html
  • usr/share/doc/qt/qtqml/qtqml-cppintegration-exposecppattributes.html
  • usr/share/doc/qt/qtqml/qtqml-cppintegration-interactqmlfromcpp.html
  • usr/share/doc/qt/qtqml/qtqml-cppintegration-overview.html
  • usr/share/doc/qt/qtqml/qtqml-cppintegration-topic.html
  • usr/share/doc/qt/qtqml/qtqml-documents-definetypes.html
  • usr/share/doc/qt/qtqml/qtqml-documents-networktransparency.html
  • usr/share/doc/qt/qtqml/qtqml-documents-scope.html
  • usr/share/doc/qt/qtqml/qtqml-documents-structure.html
  • usr/share/doc/qt/qtqml/qtqml-documents-topic.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-content-button-qml.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-content-genericsceneitem-qml.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-content-itemcreation-js.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-content-paletteitem-qml.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-content-perspectiveitem-qml.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-content-sun-qml.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-dynamicscene-qml.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-dynamicscene-qmlproject.html
  • usr/share/doc/qt/qtqml/qtqml-dynamicscene-example.html
  • usr/share/doc/qt/qtqml/qtqml-index.html
  • usr/share/doc/qt/qtqml/qtqml-javascript-dynamicobjectcreation.html
  • usr/share/doc/qt/qtqml/qtqml-javascript-expressions.html
  • usr/share/doc/qt/qtqml/qtqml-javascript-functionlist.html
  • usr/share/doc/qt/qtqml/qtqml-javascript-hostenvironment.html
  • usr/share/doc/qt/qtqml/qtqml-javascript-imports.html
  • usr/share/doc/qt/qtqml/qtqml-javascript-qmlglobalobject.html
  • usr/share/doc/qt/qtqml/qtqml-javascript-resources.html
  • usr/share/doc/qt/qtqml/qtqml-javascript-topic.html
  • usr/share/doc/qt/qtqml/qtqml-models-qmlmodule.html
  • usr/share/doc/qt/qtqml/qtqml-module.html
  • usr/share/doc/qt/qtqml/qtqml-modules-cppplugins.html
  • usr/share/doc/qt/qtqml/qtqml-modules-identifiedmodules.html
  • usr/share/doc/qt/qtqml/qtqml-modules-legacymodules.html
  • usr/share/doc/qt/qtqml/qtqml-modules-qmldir.html
  • usr/share/doc/qt/qtqml/qtqml-modules-topic.html
  • usr/share/doc/qt/qtqml/qtqml-networkaccessmanagerfactory-example.html
  • usr/share/doc/qt/qtqml/qtqml-networkaccessmanagerfactory-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-pro.html
  • usr/share/doc/qt/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qmlproject.html
  • usr/share/doc/qt/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-networkaccessmanagerfactory-view-qml.html
  • usr/share/doc/qt/qtqml/qtqml-qml-i18n-example.html
  • usr/share/doc/qt/qtqml/qtqml-qml-i18n-qml-i18n-qml.html
  • usr/share/doc/qt/qtqml/qtqml-qml-i18n-qml-i18n-qmlproject.html
  • usr/share/doc/qt/qtqml/qtqml-qmlextensionplugins-example.html
  • usr/share/doc/qt/qtqml/qtqml-qmlextensionplugins-imports-timeexample-clock-qml.html
  • usr/share/doc/qt/qtqml/qtqml-qmlextensionplugins-imports-timeexample-qmldir.html
  • usr/share/doc/qt/qtqml/qtqml-qmlextensionplugins-plugin-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-qmlextensionplugins-plugins-qml.html
  • usr/share/doc/qt/qtqml/qtqml-qmlextensionplugins-plugins-qmlproject.html
  • usr/share/doc/qt/qtqml/qtqml-qmlextensionplugins-qmlextensionplugins-pro.html
  • usr/share/doc/qt/qtqml/qtqml-qmlmodule.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-adding-adding-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-adding-adding-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-adding-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-adding-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-adding-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-adding-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-adding-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-attached-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-attached-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-binding-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-binding-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-coercion-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-coercion-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-default-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-default-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-extended-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-extended-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-extended-extended-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-extended-extended-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-extended-lineedit-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-extended-lineedit-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-extended-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-grouped-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-grouped-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-methods-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-methods-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-properties-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-properties-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-signal-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-signal-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-example-qml.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-example.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-person-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-person-h.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-valuesource-pro.html
  • usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-valuesource-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-statemachine-qmlmodule.html
  • usr/share/doc/qt/qtqml/qtqml-syntax-basics.html
  • usr/share/doc/qt/qtqml/qtqml-syntax-directoryimports.html
  • usr/share/doc/qt/qtqml/qtqml-syntax-imports.html
  • usr/share/doc/qt/qtqml/qtqml-syntax-objectattributes.html
  • usr/share/doc/qt/qtqml/qtqml-syntax-propertybinding.html
  • usr/share/doc/qt/qtqml/qtqml-syntax-signals.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-app-qml.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-pro.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-app-qml.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-pro.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-app-qml.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-pro.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-app-qml.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-pro.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-app-qml.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-pro.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-pro.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qml.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qrc.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-chapter6-plugins-pro.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-import-pro.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-h.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-qmldir.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-example.html
  • usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-extending-qml-pro.html
  • usr/share/doc/qt/qtqml/qtqml-typesystem-basictypes.html
  • usr/share/doc/qt/qtqml/qtqml-typesystem-objecttypes.html
  • usr/share/doc/qt/qtqml/qtqml-typesystem-topic.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-data-xml.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-example.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-get-qml.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-getform-ui-qml.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-main-cpp.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-methods-js.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-xmlhttprequest-pro.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qml.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qmlproject.html
  • usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qrc.html
  • usr/share/doc/qt/qtqml/qtqml.html
  • usr/share/doc/qt/qtqml/qtqml.index
  • usr/share/doc/qt/qtqml/qtqml.qhp
  • usr/share/doc/qt/qtqml/qtqml.qhp.sha1
  • usr/share/doc/qt/qtqml/qtqml.tags
  • usr/share/doc/qt/qtqml/style/
  • usr/share/doc/qt/qtqml/style/offline-simple.css
  • usr/share/doc/qt/qtqml/style/offline.css
  • usr/share/doc/qt/qtqmltest.qch
  • usr/share/doc/qt/qtqmltest/
  • usr/share/doc/qt/qtqmltest/images/
  • usr/share/doc/qt/qtqmltest/images/arrow_bc.png
  • usr/share/doc/qt/qtqmltest/images/bgrContent.png
  • usr/share/doc/qt/qtqmltest/images/btn_next.png
  • usr/share/doc/qt/qtqmltest/images/btn_prev.png
  • usr/share/doc/qt/qtqmltest/images/bullet_dn.png
  • usr/share/doc/qt/qtqmltest/images/bullet_sq.png
  • usr/share/doc/qt/qtqmltest/images/home.png
  • usr/share/doc/qt/qtqmltest/images/ico_note.png
  • usr/share/doc/qt/qtqmltest/images/ico_note_attention.png
  • usr/share/doc/qt/qtqmltest/images/ico_out.png
  • usr/share/doc/qt/qtqmltest/images/logo.png
  • usr/share/doc/qt/qtqmltest/qtqmltest.index
  • usr/share/doc/qt/qtqmltest/qtqmltest.qhp
  • usr/share/doc/qt/qtqmltest/qtqmltest.qhp.sha1
  • usr/share/doc/qt/qtqmltest/qtqmltest.tags
  • usr/share/doc/qt/qtqmltest/qtquicktest-index.html
  • usr/share/doc/qt/qtqmltest/style/
  • usr/share/doc/qt/qtqmltest/style/offline-simple.css
  • usr/share/doc/qt/qtqmltest/style/offline.css
  • usr/share/doc/qt/qtquick.qch
  • usr/share/doc/qt/qtquick/
  • usr/share/doc/qt/qtquick/examples-manifest.xml
  • usr/share/doc/qt/qtquick/images/
  • usr/share/doc/qt/qtquick/images/3d-rotation-axis.png
  • usr/share/doc/qt/qtquick/images/9BcAYDlpuT8.jpg
  • usr/share/doc/qt/qtquick/images/ListViewHorizontal.png
  • usr/share/doc/qt/qtquick/images/anchor_ordering.png
  • usr/share/doc/qt/qtquick/images/anchor_ordering_bad.png
  • usr/share/doc/qt/qtquick/images/anchorchanges.png
  • usr/share/doc/qt/qtquick/images/animatedimageitem.gif
  • usr/share/doc/qt/qtquick/images/animatedsprite-loading-frames.png
  • usr/share/doc/qt/qtquick/images/animatedsprite-loading-interpolated.gif
  • usr/share/doc/qt/qtquick/images/animatedsprite-loading.gif
  • usr/share/doc/qt/qtquick/images/animatedsprite-loading.png
  • usr/share/doc/qt/qtquick/images/arrow_bc.png
  • usr/share/doc/qt/qtquick/images/axisrotation.png
  • usr/share/doc/qt/qtquick/images/bgrContent.png
  • usr/share/doc/qt/qtquick/images/btn_next.png
  • usr/share/doc/qt/qtquick/images/btn_prev.png
  • usr/share/doc/qt/qtquick/images/bullet_dn.png
  • usr/share/doc/qt/qtquick/images/bullet_sq.png
  • usr/share/doc/qt/qtquick/images/columnlayout.png
  • usr/share/doc/qt/qtquick/images/custom-geometry-example.png
  • usr/share/doc/qt/qtquick/images/declarative-adv-tutorial1.png
  • usr/share/doc/qt/qtquick/images/declarative-adv-tutorial2.png
  • usr/share/doc/qt/qtquick/images/declarative-adv-tutorial3.png
  • usr/share/doc/qt/qtquick/images/declarative-adv-tutorial4.gif
  • usr/share/doc/qt/qtquick/images/declarative-anchors_example.png
  • usr/share/doc/qt/qtquick/images/declarative-anchors_example2.png
  • usr/share/doc/qt/qtquick/images/declarative-arcdirection.png
  • usr/share/doc/qt/qtquick/images/declarative-arcradius.png
  • usr/share/doc/qt/qtquick/images/declarative-arcrotation.png
  • usr/share/doc/qt/qtquick/images/declarative-colors.png
  • usr/share/doc/qt/qtquick/images/declarative-gridmesh.png
  • usr/share/doc/qt/qtquick/images/declarative-item_opacity1.png
  • usr/share/doc/qt/qtquick/images/declarative-item_opacity2.png
  • usr/share/doc/qt/qtquick/images/declarative-item_stacking1.png
  • usr/share/doc/qt/qtquick/images/declarative-item_stacking2.png
  • usr/share/doc/qt/qtquick/images/declarative-item_stacking3.png
  • usr/share/doc/qt/qtquick/images/declarative-item_stacking4.png
  • usr/share/doc/qt/qtquick/images/declarative-largearc.png
  • usr/share/doc/qt/qtquick/images/declarative-nopercent.png
  • usr/share/doc/qt/qtquick/images/declarative-patharc.png
  • usr/share/doc/qt/qtquick/images/declarative-pathattribute.png
  • usr/share/doc/qt/qtquick/images/declarative-pathcubic.png
  • usr/share/doc/qt/qtquick/images/declarative-pathcurve.png
  • usr/share/doc/qt/qtquick/images/declarative-pathquad.png
  • usr/share/doc/qt/qtquick/images/declarative-pathsvg.png
  • usr/share/doc/qt/qtquick/images/declarative-percent.png
  • usr/share/doc/qt/qtquick/images/declarative-qmlfocus1.png
  • usr/share/doc/qt/qtquick/images/declarative-qmlfocus2.png
  • usr/share/doc/qt/qtquick/images/declarative-qmlfocus3.png
  • usr/share/doc/qt/qtquick/images/declarative-qmlfocus4.png
  • usr/share/doc/qt/qtquick/images/declarative-qmlfocus5.png
  • usr/share/doc/qt/qtquick/images/declarative-qtlogo-preserveaspectcrop.png
  • usr/share/doc/qt/qtquick/images/declarative-qtlogo-preserveaspectfit.png
  • usr/share/doc/qt/qtquick/images/declarative-qtlogo-stretch.png
  • usr/share/doc/qt/qtquick/images/declarative-qtlogo-tile.png
  • usr/share/doc/qt/qtquick/images/declarative-qtlogo-tilehorizontally.png
  • usr/share/doc/qt/qtquick/images/declarative-qtlogo-tilevertically.png
  • usr/share/doc/qt/qtquick/images/declarative-qtlogo.png
  • usr/share/doc/qt/qtquick/images/declarative-rect.png
  • usr/share/doc/qt/qtquick/images/declarative-rect_gradient.png
  • usr/share/doc/qt/qtquick/images/declarative-rotation.png
  • usr/share/doc/qt/qtquick/images/declarative-samegame.png
  • usr/share/doc/qt/qtquick/images/declarative-scale.png
  • usr/share/doc/qt/qtquick/images/declarative-scalegrid.png
  • usr/share/doc/qt/qtquick/images/declarative-shadereffectitem.png
  • usr/share/doc/qt/qtquick/images/declarative-shadereffectsource.png
  • usr/share/doc/qt/qtquick/images/declarative-text.png
  • usr/share/doc/qt/qtquick/images/declarative-textballoons_example.png
  • usr/share/doc/qt/qtquick/images/declarative-textedit.gif
  • usr/share/doc/qt/qtquick/images/declarative-textformat.png
  • usr/share/doc/qt/qtquick/images/declarative-textstyle.png
  • usr/share/doc/qt/qtquick/images/declarative-transformorigin.png
  • usr/share/doc/qt/qtquick/images/declarative-tutorial1.png
  • usr/share/doc/qt/qtquick/images/declarative-tutorial2.png
  • usr/share/doc/qt/qtquick/images/declarative-tutorial3_animation.gif
  • usr/share/doc/qt/qtquick/images/edge1.png
  • usr/share/doc/qt/qtquick/images/edge2.png
  • usr/share/doc/qt/qtquick/images/edge3.png
  • usr/share/doc/qt/qtquick/images/edge4.png
  • usr/share/doc/qt/qtquick/images/edges_qml.png
  • usr/share/doc/qt/qtquick/images/flickable-contentXY-bottom-left.png
  • usr/share/doc/qt/qtquick/images/flickable-contentXY-bottom-right.png
  • usr/share/doc/qt/qtquick/images/flickable-contentXY-resting.png
  • usr/share/doc/qt/qtquick/images/flickable-contentXY-top-left.png
  • usr/share/doc/qt/qtquick/images/flickable-contentXY-top-right.png
  • usr/share/doc/qt/qtquick/images/flickable-rebound.gif
  • usr/share/doc/qt/qtquick/images/flickable.gif
  • usr/share/doc/qt/qtquick/images/flipable.gif
  • usr/share/doc/qt/qtquick/images/fuzzydot.png
  • usr/share/doc/qt/qtquick/images/gameoflife.png
  • usr/share/doc/qt/qtquick/images/glowdot.png
  • usr/share/doc/qt/qtquick/images/graph-example.jpg
  • usr/share/doc/qt/qtquick/images/gridLayout_aligncenter.png
  • usr/share/doc/qt/qtquick/images/gridLayout_aligntop.png
  • usr/share/doc/qt/qtquick/images/gridLayout_aligntopleft.png
  • usr/share/doc/qt/qtquick/images/gridLayout_example.png
  • usr/share/doc/qt/qtquick/images/gridlayout.png
  • usr/share/doc/qt/qtquick/images/gridview-highlight.png
  • usr/share/doc/qt/qtquick/images/gridview-layout-lefttoright-ltr-btt.png
  • usr/share/doc/qt/qtquick/images/gridview-layout-lefttoright-ltr-ttb.png
  • usr/share/doc/qt/qtquick/images/gridview-layout-lefttoright-rtl-btt.png
  • usr/share/doc/qt/qtquick/images/gridview-layout-lefttoright-rtl-ttb.png
  • usr/share/doc/qt/qtquick/images/gridview-layout-toptobottom-ltr-btt.png
  • usr/share/doc/qt/qtquick/images/gridview-layout-toptobottom-ltr-ttb.png
  • usr/share/doc/qt/qtquick/images/gridview-layout-toptobottom-rtl-btt.png
  • usr/share/doc/qt/qtquick/images/gridview-layout-toptobottom-rtl-ttb.png
  • usr/share/doc/qt/qtquick/images/gridview-simple.png
  • usr/share/doc/qt/qtquick/images/home.png
  • usr/share/doc/qt/qtquick/images/horizontalpositioner_example.png
  • usr/share/doc/qt/qtquick/images/ico_note.png
  • usr/share/doc/qt/qtquick/images/ico_note_attention.png
  • usr/share/doc/qt/qtquick/images/ico_out.png
  • usr/share/doc/qt/qtquick/images/imageprovider.png
  • usr/share/doc/qt/qtquick/images/layoutmirroring.png
  • usr/share/doc/qt/qtquick/images/listview-decorations.png
  • usr/share/doc/qt/qtquick/images/listview-highlight.png
  • usr/share/doc/qt/qtquick/images/listview-layout-bottomtotop.png
  • usr/share/doc/qt/qtquick/images/listview-layout-lefttoright.png
  • usr/share/doc/qt/qtquick/images/listview-layout-righttoleft.png
  • usr/share/doc/qt/qtquick/images/listview-layout-toptobottom.png
  • usr/share/doc/qt/qtquick/images/listview-section.png
  • usr/share/doc/qt/qtquick/images/listview-setup.png
  • usr/share/doc/qt/qtquick/images/listview-simple.png
  • usr/share/doc/qt/qtquick/images/logo.png
  • usr/share/doc/qt/qtquick/images/manual-layout.png
  • usr/share/doc/qt/qtquick/images/margins_qml.png
  • usr/share/doc/qt/qtquick/images/modelview-overview.png
  • usr/share/doc/qt/qtquick/images/openglunderqml-example.jpg
  • usr/share/doc/qt/qtquick/images/parentchange.png
  • usr/share/doc/qt/qtquick/images/pathitem-code-example.png
  • usr/share/doc/qt/qtquick/images/pathview.gif
  • usr/share/doc/qt/qtquick/images/pointerHandlerMargin.png
  • usr/share/doc/qt/qtquick/images/positioner-example.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inback.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inbounce.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-incirc.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-incubic.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inelastic.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inexpo.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutback.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutbounce.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutcirc.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutcubic.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutelastic.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutexpo.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutquad.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutquart.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutquint.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inoutsine.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inquad.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inquart.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-inquint.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-insine.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-linear.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outback.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outbounce.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outcirc.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outcubic.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outelastic.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outexpo.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outinback.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outinbounce.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outincirc.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outincubic.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outinelastic.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outinexpo.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outinquad.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outinquart.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outinquint.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outinsine.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outquad.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outquart.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outquint.png
  • usr/share/doc/qt/qtquick/images/qeasingcurve-outsine.png
  • usr/share/doc/qt/qtquick/images/qml-abstractitemmodel-example.png
  • usr/share/doc/qt/qtquick/images/qml-affectors-example.png
  • usr/share/doc/qt/qtquick/images/qml-animations-example.png
  • usr/share/doc/qt/qtquick/images/qml-blending-layered.png
  • usr/share/doc/qt/qtquick/images/qml-blending-nonlayered.png
  • usr/share/doc/qt/qtquick/images/qml-borderimage-normal-image.png
  • usr/share/doc/qt/qtquick/images/qml-borderimage-scaled.png
  • usr/share/doc/qt/qtquick/images/qml-borderimage-tiled.png
  • usr/share/doc/qt/qtquick/images/qml-canvas-example.png
  • usr/share/doc/qt/qtquick/images/qml-column.png
  • usr/share/doc/qt/qtquick/images/qml-customparticle-example.png
  • usr/share/doc/qt/qtquick/images/qml-dialcontrol-example.png
  • usr/share/doc/qt/qtquick/images/qml-dnd2-example.png
  • usr/share/doc/qt/qtquick/images/qml-draganddrop-example.png
  • usr/share/doc/qt/qtquick/images/qml-emitters-example.png
  • usr/share/doc/qt/qtquick/images/qml-flipable-example.png
  • usr/share/doc/qt/qtquick/images/qml-flow-snippet.png
  • usr/share/doc/qt/qtquick/images/qml-flow-text1.png
  • usr/share/doc/qt/qtquick/images/qml-flow-text2.png
  • usr/share/doc/qt/qtquick/images/qml-gradient.png
  • usr/share/doc/qt/qtquick/images/qml-grid-no-spacing.png
  • usr/share/doc/qt/qtquick/images/qml-grid-spacing.png
  • usr/share/doc/qt/qtquick/images/qml-imageelements-example.png
  • usr/share/doc/qt/qtquick/images/qml-imageparticle-example.png
  • usr/share/doc/qt/qtquick/images/qml-imageprovider-example.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-arc.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-arcTo.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-bezierCurveTo.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-clip-complex.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-context.gif
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-lineDash.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-math-rotate.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-math.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-rotate.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-scale.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-scalex.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-scaley.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-skewx.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-skewy.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-startAngle.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-translate.png
  • usr/share/doc/qt/qtquick/images/qml-item-canvas-translatey.png
  • usr/share/doc/qt/qtquick/images/qml-keyinteraction-example.png
  • usr/share/doc/qt/qtquick/images/qml-listview-sections-example.png
  • usr/share/doc/qt/qtquick/images/qml-localstorage-example.png
  • usr/share/doc/qt/qtquick/images/qml-modelviews-example.png
  • usr/share/doc/qt/qtquick/images/qml-mousearea-example.png
  • usr/share/doc/qt/qtquick/images/qml-mousearea-snippet.png
  • usr/share/doc/qt/qtquick/images/qml-objectlistmodel-example.png
  • usr/share/doc/qt/qtquick/images/qml-positioners-example.png
  • usr/share/doc/qt/qtquick/images/qml-righttoleft-example.png
  • usr/share/doc/qt/qtquick/images/qml-row.png
  • usr/share/doc/qt/qtquick/images/qml-scrollbar-example.png
  • usr/share/doc/qt/qtquick/images/qml-shadereffect-layereffect.png
  • usr/share/doc/qt/qtquick/images/qml-shadereffect-nolayereffect.png
  • usr/share/doc/qt/qtquick/images/qml-shadereffect-opacitymask.png
  • usr/share/doc/qt/qtquick/images/qml-shadereffects-example.png
  • usr/share/doc/qt/qtquick/images/qml-shapes-example.png
  • usr/share/doc/qt/qtquick/images/qml-stringlistmodel-example.png
  • usr/share/doc/qt/qtquick/images/qml-system-example.png
  • usr/share/doc/qt/qtquick/images/qml-tabwidget-example.png
  • usr/share/doc/qt/qtquick/images/qml-text-example.png
  • usr/share/doc/qt/qtquick/images/qml-threading-example.png
  • usr/share/doc/qt/qtquick/images/qml-touchinteraction-example.png
  • usr/share/doc/qt/qtquick/images/qml-window-example.png
  • usr/share/doc/qt/qtquick/images/qt-pixelator.png
  • usr/share/doc/qt/qtquick/images/qtlabs-wavefrontmesh.png
  • usr/share/doc/qt/qtquick/images/qtquickcontrols2-gallery-welcome.png
  • usr/share/doc/qt/qtquick/images/qtquicklayouts-example-layouts.png
  • usr/share/doc/qt/qtquick/images/qtquickwidgets-example.png
  • usr/share/doc/qt/qtquick/images/rect-color.png
  • usr/share/doc/qt/qtquick/images/rendercontrol-example.jpg
  • usr/share/doc/qt/qtquick/images/repeater-index.png
  • usr/share/doc/qt/qtquick/images/repeater-modeldata.png
  • usr/share/doc/qt/qtquick/images/repeater-simple.png
  • usr/share/doc/qt/qtquick/images/repeater.png
  • usr/share/doc/qt/qtquick/images/rowlayout-minimum.png
  • usr/share/doc/qt/qtquick/images/rowlayout.png
  • usr/share/doc/qt/qtquick/images/screen-and-window-dimensions.jpg
  • usr/share/doc/qt/qtquick/images/sg-renderloop-singlethreaded.jpg
  • usr/share/doc/qt/qtquick/images/sg-renderloop-threaded.jpg
  • usr/share/doc/qt/qtquick/images/shape-radial-gradient.png
  • usr/share/doc/qt/qtquick/images/simplematerial-example.jpg
  • usr/share/doc/qt/qtquick/images/spritecutting.png
  • usr/share/doc/qt/qtquick/images/spriteenginegraph.png
  • usr/share/doc/qt/qtquick/images/star.png
  • usr/share/doc/qt/qtquick/images/textureinsgnode-example.jpg
  • usr/share/doc/qt/qtquick/images/textureinthread-example.jpg
  • usr/share/doc/qt/qtquick/images/touchpoint-metrics.png
  • usr/share/doc/qt/qtquick/images/touchpoints-pinchhandler.png
  • usr/share/doc/qt/qtquick/images/translate.png
  • usr/share/doc/qt/qtquick/images/twotextureproviders-example.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/basics/
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/basics/images/
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/basics/images/face-smile.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/basics/images/moon.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/basics/images/shadow.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/basics/images/star.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/basics/images/sun.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/states/
  • usr/share/doc/qt/qtquick/images/used-in-examples/animation/states/qt-logo.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/canvas/
  • usr/share/doc/qt/qtquick/images/used-in-examples/canvas/contents/
  • usr/share/doc/qt/qtquick/images/used-in-examples/canvas/contents/qt-logo.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/canvas/squircle/
  • usr/share/doc/qt/qtquick/images/used-in-examples/canvas/squircle/squircle.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/dialcontrol/
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/dialcontrol/content/
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/dialcontrol/content/background.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/dialcontrol/content/needle.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/dialcontrol/content/needle_shadow.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/dialcontrol/content/overlay.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/dialcontrol/content/quit.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/flipable/
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/flipable/content/
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/flipable/content/5_heart.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/flipable/content/9_club.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/flipable/content/back.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/scrollbar/
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/scrollbar/pics/
  • usr/share/doc/qt/qtquick/images/used-in-examples/customitems/scrollbar/pics/niagara_falls.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/BearSheet.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/Uniflow_steam_engine.gif
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/arrow.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/bw.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/colors.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/qt-logo.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/shadow.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/imageelements/content/speaker.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/keyinteraction/
  • usr/share/doc/qt/qtquick/images/used-in-examples/keyinteraction/focus/
  • usr/share/doc/qt/qtquick/images/used-in-examples/keyinteraction/focus/Core/
  • usr/share/doc/qt/qtquick/images/used-in-examples/keyinteraction/focus/Core/images/
  • usr/share/doc/qt/qtquick/images/used-in-examples/keyinteraction/focus/Core/images/arrow.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/keyinteraction/focus/Core/images/qt-logo.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/shadereffects/
  • usr/share/doc/qt/qtquick/images/used-in-examples/shadereffects/content/
  • usr/share/doc/qt/qtquick/images/used-in-examples/shadereffects/content/face-smile.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/shadereffects/content/qt-logo.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/tableview/
  • usr/share/doc/qt/qtquick/images/used-in-examples/tableview/pixelator/
  • usr/share/doc/qt/qtquick/images/used-in-examples/tableview/pixelator/qt.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/imgtag/
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/imgtag/images/
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/imgtag/images/face-sad.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/imgtag/images/face-smile-big.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/imgtag/images/face-smile.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/imgtag/images/heart200.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/imgtag/images/qtlogo.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/imgtag/images/starfish_2.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/textselection/
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/textselection/pics/
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/textselection/pics/endHandle.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/text/textselection/pics/startHandle.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/flickable/
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/flickable/content/
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/flickable/content/cork.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/flickable/content/note-yellow.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/flickable/content/tack.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear0.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear1.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear2.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear3.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/BearB.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/blur-circle.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/blur-circle3.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/heart-blur.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/title.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/pincharea/
  • usr/share/doc/qt/qtquick/images/used-in-examples/touchinteraction/pincharea/qt-logo.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/pics/
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/pics/AddressBook_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/pics/AudioPlayer_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/pics/Camera_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/pics/DateBook_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/pics/EMail_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/pics/TodoList_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/gridview/pics/VideoPlayer_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/arrow-down.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/arrow-up.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/fruit-salad.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/hamburger.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/lemonade.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/list-delete.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/minus-sign.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/moreDown.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/moreUp.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/pancakes.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/plus-sign.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/listview/content/pics/vegetable-soup.jpg
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/pics/
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/pics/AddressBook_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/pics/AudioPlayer_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/pics/Camera_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/pics/DateBook_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/pics/EMail_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/pics/TodoList_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/views/pathview/pics/VideoPlayer_48.png
  • usr/share/doc/qt/qtquick/images/used-in-examples/window/
  • usr/share/doc/qt/qtquick/images/used-in-examples/window/resources/
  • usr/share/doc/qt/qtquick/images/used-in-examples/window/resources/icon64.png
  • usr/share/doc/qt/qtquick/images/verticalpositioner_example.png
  • usr/share/doc/qt/qtquick/images/verticalpositioner_transition.gif
  • usr/share/doc/qt/qtquick/images/viewtransitions-basic.gif
  • usr/share/doc/qt/qtquick/images/viewtransitions-delayedbyindex.gif
  • usr/share/doc/qt/qtquick/images/viewtransitions-intermediatemove.gif
  • usr/share/doc/qt/qtquick/images/viewtransitions-interruptedbad.gif
  • usr/share/doc/qt/qtquick/images/viewtransitions-interruptedgood.gif
  • usr/share/doc/qt/qtquick/images/viewtransitions-pathanim.gif
  • usr/share/doc/qt/qtquick/images/viewtransitions-scriptactionbad.gif
  • usr/share/doc/qt/qtquick/images/visual-coordinates-example.png
  • usr/share/doc/qt/qtquick/images/visual-parent-example.png
  • usr/share/doc/qt/qtquick/images/visual-parent-example2.png
  • usr/share/doc/qt/qtquick/images/visualcanvas_list.png
  • usr/share/doc/qt/qtquick/images/visualcanvas_overlap.png
  • usr/share/doc/qt/qtquick/images/visualize-batches.png
  • usr/share/doc/qt/qtquick/images/visualize-clip.png
  • usr/share/doc/qt/qtquick/images/visualize-original.png
  • usr/share/doc/qt/qtquick/images/visualize-overdraw-1.png
  • usr/share/doc/qt/qtquick/images/visualize-overdraw-2.png
  • usr/share/doc/qt/qtquick/images/visualpath-code-example.png
  • usr/share/doc/qt/qtquick/qml-advtutorial.html
  • usr/share/doc/qt/qtquick/qml-color.html
  • usr/share/doc/qt/qtquick/qml-dynamicview-tutorial.html
  • usr/share/doc/qt/qtquick/qml-font.html
  • usr/share/doc/qt/qtquick/qml-matrix4x4.html
  • usr/share/doc/qt/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel-members.html
  • usr/share/doc/qt/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel.html
  • usr/share/doc/qt/qtquick/qml-qt-labs-settings-settings-members.html
  • usr/share/doc/qt/qtquick/qml-qt-labs-settings-settings.html
  • usr/share/doc/qt/qtquick/qml-qt-labs-wavefrontmesh-wavefrontmesh-members.html
  • usr/share/doc/qt/qtquick/qml-qt-labs-wavefrontmesh-wavefrontmesh.html
  • usr/share/doc/qt/qtquick/qml-qtquick-accessible-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-accessible.html
  • usr/share/doc/qt/qtquick/qml-qtquick-anchoranimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-anchoranimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-anchorchanges-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-anchorchanges.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animatedimage-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animatedimage.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animatedsprite-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animatedsprite.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animationcontroller-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animationcontroller.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-animator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-behavior-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-behavior.html
  • usr/share/doc/qt/qtquick/qml-qtquick-borderimage-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-borderimage.html
  • usr/share/doc/qt/qtquick/qml-qtquick-borderimagemesh-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-borderimagemesh.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvas-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvas-obsolete.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvas.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvasgradient-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvasgradient.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvasimagedata-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvasimagedata.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvaspixelarray-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-canvaspixelarray.html
  • usr/share/doc/qt/qtquick/qml-qtquick-coloranimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-coloranimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-column-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-column.html
  • usr/share/doc/qt/qtquick/qml-qtquick-context2d-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-context2d.html
  • usr/share/doc/qt/qtquick/qml-qtquick-doublevalidator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-doublevalidator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-drag-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-drag.html
  • usr/share/doc/qt/qtquick/qml-qtquick-dragevent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-dragevent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-draghandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-draghandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-droparea-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-droparea.html
  • usr/share/doc/qt/qtquick/qml-qtquick-enterkey-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-enterkey.html
  • usr/share/doc/qt/qtquick/qml-qtquick-eventpoint-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-eventpoint.html
  • usr/share/doc/qt/qtquick/qml-qtquick-eventtouchpoint-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-eventtouchpoint.html
  • usr/share/doc/qt/qtquick/qml-qtquick-flickable-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-flickable.html
  • usr/share/doc/qt/qtquick/qml-qtquick-flipable-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-flipable.html
  • usr/share/doc/qt/qtquick/qml-qtquick-flow-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-flow.html
  • usr/share/doc/qt/qtquick/qml-qtquick-focusscope-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-focusscope.html
  • usr/share/doc/qt/qtquick/qml-qtquick-fontloader-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-fontloader.html
  • usr/share/doc/qt/qtquick/qml-qtquick-fontmetrics-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-fontmetrics.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gestureevent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gestureevent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gradient-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gradient.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gradientstop-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gradientstop.html
  • usr/share/doc/qt/qtquick/qml-qtquick-graphicsinfo-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-graphicsinfo.html
  • usr/share/doc/qt/qtquick/qml-qtquick-grid-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-grid.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gridmesh-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gridmesh.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gridview-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-gridview.html
  • usr/share/doc/qt/qtquick/qml-qtquick-handlerpoint-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-handlerpoint.html
  • usr/share/doc/qt/qtquick/qml-qtquick-hoverhandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-hoverhandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-image-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-image.html
  • usr/share/doc/qt/qtquick/qml-qtquick-intvalidator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-intvalidator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-item-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-item.html
  • usr/share/doc/qt/qtquick/qml-qtquick-itemgrabresult-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-itemgrabresult.html
  • usr/share/doc/qt/qtquick/qml-qtquick-keyevent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-keyevent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-keynavigation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-keynavigation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-keys-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-keys.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layoutmirroring-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layoutmirroring.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-columnlayout-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-columnlayout.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-gridlayout-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-gridlayout.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-layout-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-layout.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-rowlayout-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-rowlayout.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-stacklayout-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-layouts-stacklayout.html
  • usr/share/doc/qt/qtquick/qml-qtquick-listview-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-listview.html
  • usr/share/doc/qt/qtquick/qml-qtquick-loader-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-loader.html
  • usr/share/doc/qt/qtquick/qml-qtquick-matrix4x4-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-matrix4x4.html
  • usr/share/doc/qt/qtquick/qml-qtquick-mousearea-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-mousearea.html
  • usr/share/doc/qt/qtquick/qml-qtquick-mouseevent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-mouseevent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-multipointhandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-multipointhandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-multipointtoucharea-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-multipointtoucharea.html
  • usr/share/doc/qt/qtquick/qml-qtquick-numberanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-numberanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-opacityanimator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-opacityanimator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-openglinfo-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-openglinfo.html
  • usr/share/doc/qt/qtquick/qml-qtquick-parallelanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-parallelanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-parentanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-parentanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-parentchange-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-parentchange.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-affector-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-affector.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-age-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-age.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-angledirection-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-angledirection.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-attractor-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-attractor.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-cumulativedirection-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-cumulativedirection.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-customparticle-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-customparticle.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-direction-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-direction.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-ellipseshape-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-ellipseshape.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-emitter-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-emitter.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-friction-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-friction.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-gravity-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-gravity-obsolete.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-gravity.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-groupgoal-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-groupgoal.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-imageparticle-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-imageparticle.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-itemparticle-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-itemparticle.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-lineshape-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-lineshape.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-maskshape-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-maskshape.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-particle-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-particle.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-particlegroup-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-particlegroup.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-particlepainter-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-particlepainter.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-particlesystem-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-particlesystem.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-pointdirection-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-pointdirection.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-rectangleshape-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-rectangleshape.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-shape-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-shape.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-spritegoal-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-spritegoal.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-targetdirection-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-targetdirection.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-trailemitter-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-trailemitter.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-turbulence-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-turbulence.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-wander-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-particles-wander.html
  • usr/share/doc/qt/qtquick/qml-qtquick-path-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-path.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathanglearc-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathanglearc.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-patharc-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-patharc.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathattribute-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathattribute.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathcubic-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathcubic.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathcurve-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathcurve.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathelement-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathelement.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathinterpolator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathinterpolator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathline-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathline.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathmove-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathmove.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathpercent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathpercent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathquad-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathquad.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathsvg-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathsvg.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathview-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pathview.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pauseanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pauseanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pincharea-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pincharea.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pinchevent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pinchevent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pinchhandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pinchhandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointerdevice-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointerdevice.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointerdevicehandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointerdevicehandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointerevent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointerevent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointerhandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointerhandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointhandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-pointhandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-positioner-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-positioner.html
  • usr/share/doc/qt/qtquick/qml-qtquick-propertyaction-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-propertyaction.html
  • usr/share/doc/qt/qtquick/qml-qtquick-propertyanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-propertyanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-propertychanges-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-propertychanges.html
  • usr/share/doc/qt/qtquick/qml-qtquick-rectangle-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-rectangle.html
  • usr/share/doc/qt/qtquick/qml-qtquick-regexpvalidator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-regexpvalidator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-repeater-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-repeater.html
  • usr/share/doc/qt/qtquick/qml-qtquick-rotation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-rotation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-rotationanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-rotationanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-rotationanimator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-rotationanimator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-row-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-row.html
  • usr/share/doc/qt/qtquick/qml-qtquick-scale-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-scale.html
  • usr/share/doc/qt/qtquick/qml-qtquick-scaleanimator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-scaleanimator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-scriptaction-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-scriptaction.html
  • usr/share/doc/qt/qtquick/qml-qtquick-sequentialanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-sequentialanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shadereffect-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shadereffect.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shadereffectsource-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shadereffectsource.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-conicalgradient-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-conicalgradient.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-lineargradient-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-lineargradient.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-radialgradient-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-radialgradient.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-shape-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-shape.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-shapegradient-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-shapegradient.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-shapepath-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shapes-shapepath.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shortcut-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-shortcut.html
  • usr/share/doc/qt/qtquick/qml-qtquick-singlepointhandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-singlepointhandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-smoothedanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-smoothedanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-springanimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-springanimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-sprite-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-sprite.html
  • usr/share/doc/qt/qtquick/qml-qtquick-spritesequence-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-spritesequence.html
  • usr/share/doc/qt/qtquick/qml-qtquick-state-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-state.html
  • usr/share/doc/qt/qtquick/qml-qtquick-statechangescript-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-statechangescript.html
  • usr/share/doc/qt/qtquick/qml-qtquick-stategroup-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-stategroup.html
  • usr/share/doc/qt/qtquick/qml-qtquick-systempalette-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-systempalette.html
  • usr/share/doc/qt/qtquick/qml-qtquick-tableview-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-tableview.html
  • usr/share/doc/qt/qtquick/qml-qtquick-taphandler-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-taphandler.html
  • usr/share/doc/qt/qtquick/qml-qtquick-text-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-text-obsolete.html
  • usr/share/doc/qt/qtquick/qml-qtquick-text.html
  • usr/share/doc/qt/qtquick/qml-qtquick-textedit-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-textedit.html
  • usr/share/doc/qt/qtquick/qml-qtquick-textinput-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-textinput.html
  • usr/share/doc/qt/qtquick/qml-qtquick-textmetrics-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-textmetrics.html
  • usr/share/doc/qt/qtquick/qml-qtquick-touchpoint-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-touchpoint-obsolete.html
  • usr/share/doc/qt/qtquick/qml-qtquick-touchpoint.html
  • usr/share/doc/qt/qtquick/qml-qtquick-transform-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-transform.html
  • usr/share/doc/qt/qtquick/qml-qtquick-transition-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-transition.html
  • usr/share/doc/qt/qtquick/qml-qtquick-translate-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-translate.html
  • usr/share/doc/qt/qtquick/qml-qtquick-uniformanimator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-uniformanimator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-vector3danimation-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-vector3danimation.html
  • usr/share/doc/qt/qtquick/qml-qtquick-viewtransition-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-viewtransition.html
  • usr/share/doc/qt/qtquick/qml-qtquick-wheelevent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-wheelevent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-window-closeevent-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-window-closeevent.html
  • usr/share/doc/qt/qtquick/qml-qtquick-window-screen-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-window-screen-obsolete.html
  • usr/share/doc/qt/qtquick/qml-qtquick-window-screen.html
  • usr/share/doc/qt/qtquick/qml-qtquick-window-window-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-window-window.html
  • usr/share/doc/qt/qtquick/qml-qtquick-xanimator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-xanimator.html
  • usr/share/doc/qt/qtquick/qml-qtquick-yanimator-members.html
  • usr/share/doc/qt/qtquick/qml-qtquick-yanimator.html
  • usr/share/doc/qt/qtquick/qml-qttest-signalspy-members.html
  • usr/share/doc/qt/qtquick/qml-qttest-signalspy.html
  • usr/share/doc/qt/qtquick/qml-qttest-testcase-members.html
  • usr/share/doc/qt/qtquick/qml-qttest-testcase.html
  • usr/share/doc/qt/qtquick/qml-qttest-toucheventsequence-members.html
  • usr/share/doc/qt/qtquick/qml-qttest-toucheventsequence.html
  • usr/share/doc/qt/qtquick/qml-quaternion.html
  • usr/share/doc/qt/qtquick/qml-tutorial.html
  • usr/share/doc/qt/qtquick/qml-tutorial1.html
  • usr/share/doc/qt/qtquick/qml-tutorial2.html
  • usr/share/doc/qt/qtquick/qml-tutorial3.html
  • usr/share/doc/qt/qtquick/qml-vector2d.html
  • usr/share/doc/qt/qtquick/qml-vector3d.html
  • usr/share/doc/qt/qtquick/qml-vector4d.html
  • usr/share/doc/qt/qtquick/qmlexampletoggleswitch.html
  • usr/share/doc/qt/qtquick/qquickasyncimageprovider-members.html
  • usr/share/doc/qt/qtquick/qquickasyncimageprovider.html
  • usr/share/doc/qt/qtquick/qquickframebufferobject-members.html
  • usr/share/doc/qt/qtquick/qquickframebufferobject-obsolete.html
  • usr/share/doc/qt/qtquick/qquickframebufferobject-renderer-members.html
  • usr/share/doc/qt/qtquick/qquickframebufferobject-renderer.html
  • usr/share/doc/qt/qtquick/qquickframebufferobject.html
  • usr/share/doc/qt/qtquick/qquickimageprovider-members.html
  • usr/share/doc/qt/qtquick/qquickimageprovider.html
  • usr/share/doc/qt/qtquick/qquickimageresponse-members.html
  • usr/share/doc/qt/qtquick/qquickimageresponse-obsolete.html
  • usr/share/doc/qt/qtquick/qquickimageresponse.html
  • usr/share/doc/qt/qtquick/qquickitem-itemchangedata-members.html
  • usr/share/doc/qt/qtquick/qquickitem-itemchangedata.html
  • usr/share/doc/qt/qtquick/qquickitem-members.html
  • usr/share/doc/qt/qtquick/qquickitem-obsolete.html
  • usr/share/doc/qt/qtquick/qquickitem-updatepaintnodedata-members.html
  • usr/share/doc/qt/qtquick/qquickitem-updatepaintnodedata.html
  • usr/share/doc/qt/qtquick/qquickitem.html
  • usr/share/doc/qt/qtquick/qquickitemgrabresult-members.html
  • usr/share/doc/qt/qtquick/qquickitemgrabresult-obsolete.html
  • usr/share/doc/qt/qtquick/qquickitemgrabresult.html
  • usr/share/doc/qt/qtquick/qquickpainteditem-members.html
  • usr/share/doc/qt/qtquick/qquickpainteditem-obsolete.html
  • usr/share/doc/qt/qtquick/qquickpainteditem.html
  • usr/share/doc/qt/qtquick/qquickrendercontrol-members.html
  • usr/share/doc/qt/qtquick/qquickrendercontrol-obsolete.html
  • usr/share/doc/qt/qtquick/qquickrendercontrol.html
  • usr/share/doc/qt/qtquick/qquicktextdocument-members.html
  • usr/share/doc/qt/qtquick/qquicktextdocument-obsolete.html
  • usr/share/doc/qt/qtquick/qquicktextdocument.html
  • usr/share/doc/qt/qtquick/qquicktexturefactory-members.html
  • usr/share/doc/qt/qtquick/qquicktexturefactory-obsolete.html
  • usr/share/doc/qt/qtquick/qquicktexturefactory.html
  • usr/share/doc/qt/qtquick/qquickview-members.html
  • usr/share/doc/qt/qtquick/qquickview-obsolete.html
  • usr/share/doc/qt/qtquick/qquickview.html
  • usr/share/doc/qt/qtquick/qquickwidget-members.html
  • usr/share/doc/qt/qtquick/qquickwidget-obsolete.html
  • usr/share/doc/qt/qtquick/qquickwidget.html
  • usr/share/doc/qt/qtquick/qquickwindow-members.html
  • usr/share/doc/qt/qtquick/qquickwindow-obsolete.html
  • usr/share/doc/qt/qtquick/qquickwindow.html
  • usr/share/doc/qt/qtquick/qsgabstractrenderer-members.html
  • usr/share/doc/qt/qtquick/qsgabstractrenderer-obsolete.html
  • usr/share/doc/qt/qtquick/qsgabstractrenderer.html
  • usr/share/doc/qt/qtquick/qsgbasicgeometrynode-members.html
  • usr/share/doc/qt/qtquick/qsgbasicgeometrynode.html
  • usr/share/doc/qt/qtquick/qsgclipnode-members.html
  • usr/share/doc/qt/qtquick/qsgclipnode.html
  • usr/share/doc/qt/qtquick/qsgdynamictexture-members.html
  • usr/share/doc/qt/qtquick/qsgdynamictexture-obsolete.html
  • usr/share/doc/qt/qtquick/qsgdynamictexture.html
  • usr/share/doc/qt/qtquick/qsgengine-members.html
  • usr/share/doc/qt/qtquick/qsgengine-obsolete.html
  • usr/share/doc/qt/qtquick/qsgengine.html
  • usr/share/doc/qt/qtquick/qsgflatcolormaterial-members.html
  • usr/share/doc/qt/qtquick/qsgflatcolormaterial.html
  • usr/share/doc/qt/qtquick/qsggeometry-attribute-members.html
  • usr/share/doc/qt/qtquick/qsggeometry-attribute.html
  • usr/share/doc/qt/qtquick/qsggeometry-attributeset-members.html
  • usr/share/doc/qt/qtquick/qsggeometry-attributeset.html
  • usr/share/doc/qt/qtquick/qsggeometry-coloredpoint2d-members.html
  • usr/share/doc/qt/qtquick/qsggeometry-coloredpoint2d.html
  • usr/share/doc/qt/qtquick/qsggeometry-members.html
  • usr/share/doc/qt/qtquick/qsggeometry-point2d-members.html
  • usr/share/doc/qt/qtquick/qsggeometry-point2d.html
  • usr/share/doc/qt/qtquick/qsggeometry-texturedpoint2d-members.html
  • usr/share/doc/qt/qtquick/qsggeometry-texturedpoint2d.html
  • usr/share/doc/qt/qtquick/qsggeometry.html
  • usr/share/doc/qt/qtquick/qsggeometrynode-members.html
  • usr/share/doc/qt/qtquick/qsggeometrynode.html
  • usr/share/doc/qt/qtquick/qsgimagenode-members.html
  • usr/share/doc/qt/qtquick/qsgimagenode.html
  • usr/share/doc/qt/qtquick/qsgmaterial-members.html
  • usr/share/doc/qt/qtquick/qsgmaterial.html
  • usr/share/doc/qt/qtquick/qsgmaterialshader-members.html
  • usr/share/doc/qt/qtquick/qsgmaterialshader-renderstate-members.html
  • usr/share/doc/qt/qtquick/qsgmaterialshader-renderstate.html
  • usr/share/doc/qt/qtquick/qsgmaterialshader.html
  • usr/share/doc/qt/qtquick/qsgmaterialtype.html
  • usr/share/doc/qt/qtquick/qsgnode-members.html
  • usr/share/doc/qt/qtquick/qsgnode.html
  • usr/share/doc/qt/qtquick/qsgopacitynode-members.html
  • usr/share/doc/qt/qtquick/qsgopacitynode.html
  • usr/share/doc/qt/qtquick/qsgopaquetexturematerial-members.html
  • usr/share/doc/qt/qtquick/qsgopaquetexturematerial.html
  • usr/share/doc/qt/qtquick/qsgrectanglenode-members.html
  • usr/share/doc/qt/qtquick/qsgrectanglenode.html
  • usr/share/doc/qt/qtquick/qsgrendererinterface-members.html
  • usr/share/doc/qt/qtquick/qsgrendererinterface.html
  • usr/share/doc/qt/qtquick/qsgrendernode-members.html
  • usr/share/doc/qt/qtquick/qsgrendernode-renderstate-members.html
  • usr/share/doc/qt/qtquick/qsgrendernode-renderstate.html
  • usr/share/doc/qt/qtquick/qsgrendernode.html
  • usr/share/doc/qt/qtquick/qsgsimplerectnode-members.html
  • usr/share/doc/qt/qtquick/qsgsimplerectnode.html
  • usr/share/doc/qt/qtquick/qsgsimpletexturenode-members.html
  • usr/share/doc/qt/qtquick/qsgsimpletexturenode.html
  • usr/share/doc/qt/qtquick/qsgtexture-members.html
  • usr/share/doc/qt/qtquick/qsgtexture-obsolete.html
  • usr/share/doc/qt/qtquick/qsgtexture.html
  • usr/share/doc/qt/qtquick/qsgtexturematerial-members.html
  • usr/share/doc/qt/qtquick/qsgtexturematerial.html
  • usr/share/doc/qt/qtquick/qsgtextureprovider-members.html
  • usr/share/doc/qt/qtquick/qsgtextureprovider-obsolete.html
  • usr/share/doc/qt/qtquick/qsgtextureprovider.html
  • usr/share/doc/qt/qtquick/qsgtransformnode-members.html
  • usr/share/doc/qt/qtquick/qsgtransformnode.html
  • usr/share/doc/qt/qtquick/qsgvertexcolormaterial-members.html
  • usr/share/doc/qt/qtquick/qsgvertexcolormaterial.html
  • usr/share/doc/qt/qtquick/qt-labs-folderlistmodel-qmlmodule.html
  • usr/share/doc/qt/qtquick/qt-labs-qmlmodels-qmlmodule.html
  • usr/share/doc/qt/qtquick/qt-labs-settings-qmlmodule.html
  • usr/share/doc/qt/qtquick/qt-labs-sharedimage-qmlmodule.html
  • usr/share/doc/qt/qtquick/qt-labs-wavefrontmesh-qmlmodule.html
  • usr/share/doc/qt/qtquick/qtquick-animation-animation-pro.html
  • usr/share/doc/qt/qtquick/qtquick-animation-animation-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-animation-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-animation-animation-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-animation-basics-animators-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-basics-color-animation-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-basics-property-animation-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-behaviors-behavior-example-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-behaviors-siderect-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-behaviors-tvtennis-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-behaviors-wigglytext-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-easing-easing-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-example.html
  • usr/share/doc/qt/qtquick/qtquick-animation-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-animation-pathanimation-pathanimation-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-pathinterpolator-pathinterpolator-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-states-states-qml.html
  • usr/share/doc/qt/qtquick/qtquick-animation-states-transitions-qml.html
  • usr/share/doc/qt/qtquick/qtquick-bestpractices.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-beziercurve-beziercurve-qml.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-canvas-pro.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-canvas-qml.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-canvas-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-clip-clip-qml.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-example.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-quadraticcurveto-quadraticcurveto-qml.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-roundedrect-roundedrect-qml.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-smile-smile-qml.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-squircle-squircle-qml.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-tiger-tiger-js.html
  • usr/share/doc/qt/qtquick/qtquick-canvas-tiger-tiger-qml.html
  • usr/share/doc/qt/qtquick/qtquick-codesamples.html
  • usr/share/doc/qt/qtquick/qtquick-convenience-topic.html
  • usr/share/doc/qt/qtquick/qtquick-cppextensionpoints.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-content-dial-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-content-quitbutton-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-dialcontrol-pro.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-example.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-flipable-content-card-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-flipable-example.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-flipable-flipable-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-flipable-flipable-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-example.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-painteditem-pro.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-painteditem-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-textballoon-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-textballoon-h.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-textballoonplugin-plugin-h.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-textballoonplugin-qmldir.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-textballoons-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-scrollbar-example.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-scrollbar-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-scrollbar-scrollbar-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-scrollbar-scrollbar-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-tabwidget-example.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-tabwidget-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-tabwidget-tabwidget-qml.html
  • usr/share/doc/qt/qtquick/qtquick-customitems-tabwidget-tabwidget-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-draganddrop-pro.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-draganddrop-qml.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-draganddrop-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-draganddrop-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-example.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-tiles-dragtile-qml.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-tiles-droptile-qml.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-tiles-tiles-qml.html
  • usr/share/doc/qt/qtquick/qtquick-draganddrop-views-gridview-qml.html
  • usr/share/doc/qt/qtquick/qtquick-effects-particles.html
  • usr/share/doc/qt/qtquick/qtquick-effects-sprites.html
  • usr/share/doc/qt/qtquick/qtquick-effects-topic.html
  • usr/share/doc/qt/qtquick/qtquick-effects-transformations.html
  • usr/share/doc/qt/qtquick/qtquick-externaldraganddrop-draganddroptextitem-qml.html
  • usr/share/doc/qt/qtquick/qtquick-externaldraganddrop-example.html
  • usr/share/doc/qt/qtquick/qtquick-externaldraganddrop-externaldraganddrop-pro.html
  • usr/share/doc/qt/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qml.html
  • usr/share/doc/qt/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-externaldraganddrop-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-animatedimage-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-animatedsprite-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-borderimage-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-content-borderimageselector-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-content-imagecell-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-content-myborderimage-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-content-shadowrectangle-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-example.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-image-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-imageelements-pro.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-imageelements-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-imageelements-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-imageelements-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-shadows-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageelements-spritesequence-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageprovider-example.html
  • usr/share/doc/qt/qtquick/qtquick-imageprovider-imageprovider-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-imageprovider-imageprovider-example-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageprovider-imageprovider-pro.html
  • usr/share/doc/qt/qtquick/qtquick-imageprovider-imageprovider-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-imageprovider-imageprovidercore-qmldir.html
  • usr/share/doc/qt/qtquick/qtquick-imageresponseprovider-example.html
  • usr/share/doc/qt/qtquick/qtquick-imageresponseprovider-imageresponseprovider-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-imageresponseprovider-imageresponseprovider-example-qml.html
  • usr/share/doc/qt/qtquick/qtquick-imageresponseprovider-imageresponseprovider-pro.html
  • usr/share/doc/qt/qtquick/qtquick-imageresponseprovider-imageresponseprovider-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-imageresponseprovider-imageresponseprovidercore-qmldir.html
  • usr/share/doc/qt/qtquick/qtquick-index.html
  • usr/share/doc/qt/qtquick/qtquick-input-focus.html
  • usr/share/doc/qt/qtquick/qtquick-input-mouseevents.html
  • usr/share/doc/qt/qtquick/qtquick-input-textinput.html
  • usr/share/doc/qt/qtquick/qtquick-input-topic.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-example.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-focus-core-contextmenu-qml.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-focus-core-gridmenu-qml.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-focus-core-listmenu-qml.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-focus-core-listviewdelegate-qml.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-focus-core-tabmenu-qml.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-focus-focus-qml.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-keyinteraction-pro.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-keyinteraction-qml.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-keyinteraction-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-keyinteraction-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-keyinteraction-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-layouts-example.html
  • usr/share/doc/qt/qtquick/qtquick-layouts-layouts-pro.html
  • usr/share/doc/qt/qtquick/qtquick-layouts-layouts-qml.html
  • usr/share/doc/qt/qtquick/qtquick-layouts-layouts-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-layouts-layouts-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-layouts-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-layouts-qmlmodule.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-example.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-database-js.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-header-qml.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-localstorage-pro.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-localstorage-qml.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-localstorage-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-mybutton-qml.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-mydelegate-qml.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-mymodel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-localstorage-pro.html
  • usr/share/doc/qt/qtquick/qtquick-localstorage-qmlmodule.html
  • usr/share/doc/qt/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-pro.html
  • usr/share/doc/qt/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-models-abstractitemmodel-example.html
  • usr/share/doc/qt/qtquick/qtquick-models-abstractitemmodel-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-models-abstractitemmodel-model-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-models-abstractitemmodel-model-h.html
  • usr/share/doc/qt/qtquick/qtquick-models-abstractitemmodel-view-qml.html
  • usr/share/doc/qt/qtquick/qtquick-models-objectlistmodel-dataobject-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-models-objectlistmodel-dataobject-h.html
  • usr/share/doc/qt/qtquick/qtquick-models-objectlistmodel-example.html
  • usr/share/doc/qt/qtquick/qtquick-models-objectlistmodel-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-models-objectlistmodel-objectlistmodel-pro.html
  • usr/share/doc/qt/qtquick/qtquick-models-objectlistmodel-objectlistmodel-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-models-objectlistmodel-view-qml.html
  • usr/share/doc/qt/qtquick/qtquick-models-stringlistmodel-example.html
  • usr/share/doc/qt/qtquick/qtquick-models-stringlistmodel-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-models-stringlistmodel-stringlistmodel-pro.html
  • usr/share/doc/qt/qtquick/qtquick-models-stringlistmodel-stringlistmodel-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-models-stringlistmodel-view-qml.html
  • usr/share/doc/qt/qtquick/qtquick-modelviewsdata-cppmodels.html
  • usr/share/doc/qt/qtquick/qtquick-modelviewsdata-modelview.html
  • usr/share/doc/qt/qtquick/qtquick-modelviewsdata-topic.html
  • usr/share/doc/qt/qtquick/qtquick-module.html
  • usr/share/doc/qt/qtquick/qtquick-mousearea-example.html
  • usr/share/doc/qt/qtquick/qtquick-mousearea-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-mousearea-mousearea-pro.html
  • usr/share/doc/qt/qtquick/qtquick-mousearea-mousearea-qml.html
  • usr/share/doc/qt/qtquick/qtquick-mousearea-mousearea-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-mousearea-mousearea-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-mousearea-mousearea-wheel-example-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-affectors-pro.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-affectors-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-affectors-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-affectors-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-age-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-attractor-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-customaffector-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-friction-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-gravity-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-greybutton-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-groupgoal-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-move-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-spritegoal-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-turbulence-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-content-wander-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-example.html
  • usr/share/doc/qt/qtquick/qtquick-particles-affectors-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-content-blurparticles-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-content-fragmentshader-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-content-imagecolors-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-customparticle-pro.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-customparticle-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-customparticle-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-customparticle-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-example.html
  • usr/share/doc/qt/qtquick/qtquick-particles-customparticle-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-content-burstandpulse-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-content-customemitter-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-content-emitmask-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-content-maximumemitted-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-content-shapeanddirection-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-content-trailemitter-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-content-velocityfrommotion-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-emitters-pro.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-emitters-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-emitters-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-emitters-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-example.html
  • usr/share/doc/qt/qtquick/qtquick-particles-emitters-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-content-allatonce-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-content-colored-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-content-colortable-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-content-deformation-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-content-rotation-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-content-sharing-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-content-sprites-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-example.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-imageparticle-pro.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-imageparticle-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-imageparticle-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-imageparticle-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-particles-performance.html
  • usr/share/doc/qt/qtquick/qtquick-particles-qmlmodule.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-content-dynamiccomparison-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-content-dynamicemitters-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-content-multiplepainters-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-content-startstop-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-content-timedgroupchanges-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-example.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-system-pro.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-system-qml.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-system-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-particles-system-system-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-positioners-example.html
  • usr/share/doc/qt/qtquick/qtquick-positioners-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-positioners-positioners-attachedproperties-qml.html
  • usr/share/doc/qt/qtquick/qtquick-positioners-positioners-pro.html
  • usr/share/doc/qt/qtquick/qtquick-positioners-positioners-qml.html
  • usr/share/doc/qt/qtquick/qtquick-positioners-positioners-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-positioners-positioners-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-positioners-positioners-transitions-qml.html
  • usr/share/doc/qt/qtquick/qtquick-positioning-anchors.html
  • usr/share/doc/qt/qtquick/qtquick-positioning-layouts.html
  • usr/share/doc/qt/qtquick/qtquick-positioning-righttoleft.html
  • usr/share/doc/qt/qtquick/qtquick-positioning-topic.html
  • usr/share/doc/qt/qtquick/qtquick-qmlmodule.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-accessibility-qml.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-accessibility-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-accessibility-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-content-button-qml.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-content-checkbox-qml.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-content-slider-qml.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-example.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-quick-accessibility-quick-accessibility-pro.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-customgl-qml.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-example.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-fbitem-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-fbitem-h.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-pro.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquare-qml.html
  • usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquaretab-qml.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-cuberenderer-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-cuberenderer-h.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-demo-qml.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-example.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-rendercontrol-pro.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-rendercontrol-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-window-multithreaded-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-window-multithreaded-h.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-window-singlethreaded-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-rendercontrol-window-singlethreaded-h.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-example.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qml.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qml.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-righttoleft-pro.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-righttoleft-qml.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-righttoleft-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-righttoleft-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-textalignment-textalignment-qml.html
  • usr/share/doc/qt/qtquick/qtquick-righttoleft-textalignment-textalignment-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-customgeometry-beziercurve-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-customgeometry-beziercurve-h.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-customgeometry-customgeometry-pro.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-customgeometry-customgeometry-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-customgeometry-example.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-customgeometry-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-customgeometry-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-example.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-graph-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-graph-h.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-graph-pro.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-graph-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-gridnode-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-gridnode-h.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-linenode-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-linenode-h.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-noisynode-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-noisynode-h.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-materials.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-nodes.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-openglunderqml-example.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-openglunderqml-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-openglunderqml-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-pro.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-openglunderqml-squircle-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-openglunderqml-squircle-h.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-simplematerial-example.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-simplematerial-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-simplematerial-simplematerial-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-simplematerial-simplematerial-pro.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-simplematerial-simplematerial-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinsgnode-example.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-h.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinsgnode-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinsgnode-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-pro.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-error-qml.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-example.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-textureinthread-pro.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-textureinthread-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-h.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-twotextureproviders-example.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-twotextureproviders-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-twotextureproviders-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-pro.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-h.html
  • usr/share/doc/qt/qtquick/qtquick-shadereffects-content-slider-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shadereffects-example.html
  • usr/share/doc/qt/qtquick/qtquick-shadereffects-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-shadereffects-shadereffects-pro.html
  • usr/share/doc/qt/qtquick/qtquick-shadereffects-shadereffects-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shadereffects-shadereffects-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-shadereffects-shadereffects-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-clippedtigers-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-interactive-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item10-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item11-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item12-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item13-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item14-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item15-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item17-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item2-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item3-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item4-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item5-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item6-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item7-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item8-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-item9-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-sampling-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-shapegallery-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-tapabletriangle-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-content-tiger-qml.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-example.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-qmlmodule.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-shapes-pro.html
  • usr/share/doc/qt/qtquick/qtquick-shapes-shapes-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-statesanimations-animations.html
  • usr/share/doc/qt/qtquick/qtquick-statesanimations-behaviors.html
  • usr/share/doc/qt/qtquick/qtquick-statesanimations-states.html
  • usr/share/doc/qt/qtquick/qtquick-statesanimations-topic.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-gameoflife-example.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-gameoflife-gameoflife-pro.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-gameoflife-gameoflifemodel-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-gameoflife-gameoflifemodel-h.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-gameoflife-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-gameoflife-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-pixelator-example.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-pixelator-imagemodel-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-pixelator-imagemodel-h.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-pixelator-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-pixelator-main-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tableview-pixelator-pixelator-pro.html
  • usr/share/doc/qt/qtquick/qtquick-text-example.html
  • usr/share/doc/qt/qtquick/qtquick-text-fonts-availablefonts-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-fonts-banner-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-fonts-fonts-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-fonts-hello-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-imgtag-imgtag-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-imgtag-textwithimage-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-text-styledtext-layout-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-text-pro.html
  • usr/share/doc/qt/qtquick/qtquick-text-text-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-text-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-text-text-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-text-textselection-textselection-qml.html
  • usr/share/doc/qt/qtquick/qtquick-text-validator.html
  • usr/share/doc/qt/qtquick/qtquick-threading-example.html
  • usr/share/doc/qt/qtquick/qtquick-threading-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-threading-threadedlistmodel-example.html
  • usr/share/doc/qt/qtquick/qtquick-threading-threadedlistmodel-threadedlistmodel-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-threading-threadedlistmodel-timedisplay-qml.html
  • usr/share/doc/qt/qtquick/qtquick-threading-threading-pro.html
  • usr/share/doc/qt/qtquick/qtquick-threading-threading-qml.html
  • usr/share/doc/qt/qtquick/qtquick-threading-threading-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-threading-threading-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-threading-workerscript-spinner-qml.html
  • usr/share/doc/qt/qtquick/qtquick-threading-workerscript-workerscript-qml.html
  • usr/share/doc/qt/qtquick/qtquick-threading-workerscript-workerscript-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-tools-and-utilities.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-example.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-flickable-basic-flickable-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-flickable-content-panel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-flickable-corkboards-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-multipointtouch-bearwhack-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-multipointtouch-content-augmentedtouchpoint-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-multipointtouch-content-bearwhackparticlesystem-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-multipointtouch-content-particleflame-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-multipointtouch-multiflame-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-pincharea-flickresize-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-touchinteraction-pro.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-touchinteraction-qml.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-touchinteraction-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-touchinteraction-touchinteraction-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview1-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview1-example.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview1-petsmodel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview2-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview2-example.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview2-petsmodel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview3-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview3-example.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview3-petsmodel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview4-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview4-example.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview4-listselector-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview4-petsmodel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame1-block-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame1-button-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame1-example.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame1-samegame-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame1-samegame1-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame2-block-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame2-button-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame2-example.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame2-samegame-js.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame2-samegame-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame2-samegame2-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame3-block-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame3-button-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame3-dialog-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame3-example.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame3-samegame-js.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame3-samegame-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame3-samegame3-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-content-boomblock-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-content-button-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-content-dialog-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-content-samegame-js.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-example.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-highscores-score-data-xml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-samegame-qml.html
  • usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-samegame4-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-views-delegatemodel-delegatemodel-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-views-delegatemodel-dragselection-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-delegatemodel-slideshow-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-example.html
  • usr/share/doc/qt/qtquick/qtquick-views-gridview-gridview-example-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-content-petsmodel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-content-pressandholdbutton-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-content-recipesmodel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-content-smalltext-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-content-textbutton-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-content-togglebutton-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-displaymargin-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-dynamiclist-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-expandingdelegates-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-highlight-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-highlightranges-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-listview-sections-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-views-objectmodel-objectmodel-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-package-delegate-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-package-view-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-pathview-pathview-example-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-views-pro.html
  • usr/share/doc/qt/qtquick/qtquick-views-views-qml.html
  • usr/share/doc/qt/qtquick/qtquick-views-views-qmlproject.html
  • usr/share/doc/qt/qtquick/qtquick-views-views-qrc.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-adaptations-d3d12.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-adaptations-openvg.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-adaptations-software.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-adaptations.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-coordinates.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-scenegraph-renderer.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-scenegraph.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-topic.html
  • usr/share/doc/qt/qtquick/qtquick-visualcanvas-visualparent.html
  • usr/share/doc/qt/qtquick/qtquick-visualtypes-topic.html
  • usr/share/doc/qt/qtquick/qtquick-window-allscreens-qml.html
  • usr/share/doc/qt/qtquick/qtquick-window-currentscreen-qml.html
  • usr/share/doc/qt/qtquick/qtquick-window-example.html
  • usr/share/doc/qt/qtquick/qtquick-window-main-cpp.html
  • usr/share/doc/qt/qtquick/qtquick-window-qmlmodule.html
  • usr/share/doc/qt/qtquick/qtquick-window-resources-icon-svg.html
  • usr/share/doc/qt/qtquick/qtquick-window-splash-qml.html
  • usr/share/doc/qt/qtquick/qtquick-window-window-pro.html
  • usr/share/doc/qt/qtquick/qtquick-window-window-qml.html
  • usr/share/doc/qt/qtquick/qtquick-window-window-qrc.html
  • usr/share/doc/qt/qtquick/qtquick.index
  • usr/share/doc/qt/qtquick/qtquick.qhp
  • usr/share/doc/qt/qtquick/qtquick.qhp.sha1
  • usr/share/doc/qt/qtquick/qtquick.tags
  • usr/share/doc/qt/qtquick/qtquickhandlers-index.html
  • usr/share/doc/qt/qtquick/qtquicklayouts-index.html
  • usr/share/doc/qt/qtquick/qtquicklayouts-overview.html
  • usr/share/doc/qt/qtquick/qtquickwidgets-module.html
  • usr/share/doc/qt/qtquick/qttest-qmlmodule.html
  • usr/share/doc/qt/qtquick/style/
  • usr/share/doc/qt/qtquick/style/offline-simple.css
  • usr/share/doc/qt/qtquick/style/offline.css
  • usr/share/doc/qt/qtquickcontrols.qch
  • usr/share/doc/qt/qtquickcontrols/
  • usr/share/doc/qt/qtquickcontrols/examples-manifest.xml
  • usr/share/doc/qt/qtquickcontrols/images/
  • usr/share/doc/qt/qtquickcontrols/images/applicationwindow-background.png
  • usr/share/doc/qt/qtquickcontrols/images/applicationwindow-overlay-modal.png
  • usr/share/doc/qt/qtquickcontrols/images/applicationwindow-overlay.png
  • usr/share/doc/qt/qtquickcontrols/images/arrow_bc.png
  • usr/share/doc/qt/qtquickcontrols/images/bgrContent.png
  • usr/share/doc/qt/qtquickcontrols/images/btn_next.png
  • usr/share/doc/qt/qtquickcontrols/images/btn_prev.png
  • usr/share/doc/qt/qtquickcontrols/images/bullet_dn.png
  • usr/share/doc/qt/qtquickcontrols/images/bullet_sq.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-checked-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-checked-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-checked-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-flat-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-flat-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-flat-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-flat-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-flat.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/button-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-partially-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-partially-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-partially-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-partially-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-partially-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-partially-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-partially-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-partially-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background-editable-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background-editable-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background-editable.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background-open.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-editable-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-editable-mirrored-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-editable-mirrored.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-editable.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/combobox-popup.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-checked-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-checked-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-disabled-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-mask.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-progress-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/delaybutton-progress.9.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-background-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-background-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-background.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-handle-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-handle-focused-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-handle-focused-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-handle-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-handle-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-handle-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/dial-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/dialog-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/dialog-overlay-modal.png
  • usr/share/doc/qt/qtquickcontrols/images/dialog-overlay.png
  • usr/share/doc/qt/qtquickcontrols/images/dialogbuttonbox-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/drawer-background-bottom.9.png
  • usr/share/doc/qt/qtquickcontrols/images/drawer-background-left.9.png
  • usr/share/doc/qt/qtquickcontrols/images/drawer-background-right.9.png
  • usr/share/doc/qt/qtquickcontrols/images/drawer-background-top.9.png
  • usr/share/doc/qt/qtquickcontrols/images/drawer-overlay-modal.png
  • usr/share/doc/qt/qtquickcontrols/images/drawer-overlay.png
  • usr/share/doc/qt/qtquickcontrols/images/frame-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/groupbox-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/groupbox-title.9.png
  • usr/share/doc/qt/qtquickcontrols/images/home.png
  • usr/share/doc/qt/qtquickcontrols/images/ico_note.png
  • usr/share/doc/qt/qtquickcontrols/images/ico_note_attention.png
  • usr/share/doc/qt/qtquickcontrols/images/ico_out.png
  • usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-highlighted.9.png
  • usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/logo.png
  • usr/share/doc/qt/qtquickcontrols/images/menu-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-arrow-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-arrow-mirrored-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-arrow-mirrored.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-arrow.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-background-highlighted.9.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/menuseparator-separator.9.png
  • usr/share/doc/qt/qtquickcontrols/images/page-background.png
  • usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate-current.png
  • usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate-disabled-current.png
  • usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate.png
  • usr/share/doc/qt/qtquickcontrols/images/pane-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/popup-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/popup-overlay-modal.png
  • usr/share/doc/qt/qtquickcontrols/images/popup-overlay.png
  • usr/share/doc/qt/qtquickcontrols/images/progressbar-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/progressbar-mask.9.png
  • usr/share/doc/qt/qtquickcontrols/images/progressbar-progress.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-applicationwindow-wireframe.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-automotive.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-busyindicator-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-busyindicator.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-busyindicator.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-flat.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-highlighted.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-icononly.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-textbesideicon.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-textonly.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-textundericon.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter1.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter2-listview-header.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter2.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3-listview-header.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3-view-margins.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4-long-message.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4-message-timestamp.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-test.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-test.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkbox-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkbox-group.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkbox-tristate.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkbox.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkdelegate-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkdelegate-tristate.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkdelegate.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-combobox-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-combobox.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-contactlist.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-control.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-customize-buttons.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-default-thumbnail.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-default.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-delaybutton-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-delaybutton.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial-inputmode.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial-no-wrap.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial-wrap.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dialogbuttonbox.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-drawer-expanded-wireframe.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-drawer.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-flatstyle-creator.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-flatstyle.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-frame-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-frame.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-fusion-palettes.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-fusion-thumbnail.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-fusion-violet.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-fusion.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-gallery-drawer.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-gallery-menu.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-gallery-welcome.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-groupbox-checkable.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-groupbox-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-groupbox.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-4x.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-inset-boundaries.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-inset.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-resized-padding.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-resized-stretchable.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-size.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-customization-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-thumbnail.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-itemdelegate-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-itemdelegate.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-label-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-label.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-accent.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-attributes.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-background.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-elevation.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-foreground.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-light.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-purple.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-theme.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-thumbnail.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-variant-dense.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-variant-normal.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menu-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menu.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menubar-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menubar.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menuseparator.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-musicplayer.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-page-wireframe.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-pageindicator-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-pageindicator.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-pane-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-pane.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-popup-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-popup-settings.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-popup-transformorigin.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-popup.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-progressbar-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-progressbar-indeterminate.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-progressbar.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-radiobutton-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-radiobutton.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-radiodelegate-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-radiodelegate.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-rangeslider-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-rangeslider.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-roundbutton.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-non-attached.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-nosnap.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-snapalways.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-snaponrelease.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollindicator-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollindicator-non-attached.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollindicator.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollview-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollview-wireframe.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollview.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-sidepanel-landscape.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-sidepanel-portrait.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider-nosnap.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider-snapalways.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider-snaponrelease.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-spinbox-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-spinbox-double.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-spinbox-textual.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-spinbox.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-pop.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-push.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-replace.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-unwind.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-visible.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-wireframe.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-styles.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipedelegate-behind.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipedelegate-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipedelegate-leading-trailing.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipedelegate.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipetoremove.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipeview-wireframe.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipeview.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switch-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switch.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switch.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switchdelegate-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switchdelegate.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbar-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbar-explicit.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbar-flickable.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbar-wireframe.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbutton.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textarea-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textarea-scrollable.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textarea.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-texteditor-desktop.jpg
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-texteditor-touch.jpg
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield-normal.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolbar-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolbar.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolbutton-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolbutton.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolseparator-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolseparator.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tooltip-slider.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tooltip.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tumbler-custom.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tumbler-wrap.gif
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tumbler.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-accent.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-attributes.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-background.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-foreground.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-light.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-theme.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-thumbnail.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-violet.png
  • usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-wearable.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-background-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-background-vertical.9.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-focused-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-focused-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-progress-horizontal-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-progress-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-progress-vertical-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/rangeslider-progress-vertical.9.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-disabled-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-highlighted-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-highlighted-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-highlighted-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-highlighted.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/roundbutton-background.png
  • usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-interactive-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-interactive-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-interactive-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-interactive.png
  • usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/scrollindicator-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-background-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-background-vertical.9.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-handle-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-handle-focused-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-handle-focused-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-handle-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-handle-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-handle-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-progress-horizontal-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-progress-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-progress-vertical-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/slider-progress-vertical.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-background-editable.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable-mirrored.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-mirrored.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable-mirrored.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-mirrored.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up.9.png
  • usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-handle-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-handle-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/switch-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-handle-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-checked-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-focused.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/tabbar-background.png
  • usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-disabled-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/tabbutton-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/textarea-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/textarea-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/textarea-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/textfield-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/textfield-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/textfield-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbar-background.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-checked-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-checked-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-disabled-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-focused.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolbutton-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolseparator-separator-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/toolseparator-separator-vertical.9.png
  • usr/share/doc/qt/qtquickcontrols/images/tooltip-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Albert_Einstein.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Albert_Einstein@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Albert_Einstein@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Albert_Einstein@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Ernest_Hemingway.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Hans_Gude.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Hans_Gude@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Hans_Gude@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/chattutorial/shared/Hans_Gude@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20/back.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20/drawer.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20/menu.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@2/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@2/back.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@2/drawer.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@2/menu.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@3/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@3/back.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@3/drawer.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@3/menu.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@4/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@4/back.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@4/drawer.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@4/menu.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/arrow.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/arrow@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/arrow@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/arrow@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/arrows.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/arrows@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/arrows@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/arrows@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/qt-logo.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/qt-logo@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/qt-logo@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/gallery/images/qt-logo@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/air-con.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/command.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/message.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/music.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/seats.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/settings.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/statistics.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/windows.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/air-con.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/command.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/message.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/music.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/navigation.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/seats.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/settings.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/statistics.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/windows.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/car.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/car@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/warning.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/warning@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/weather.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/weather@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/applicationwindow-background.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/applicationwindow-background@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-checked-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-checked-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-checked@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-pressed@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-handle-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-handle-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-handle@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/frame-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/frame-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-checked@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-pressed@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/scrollindicator-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/scrollindicator-handle@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-background-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-background-horizontal@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-progress-horizontal-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-progress-horizontal-pressed@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-progress-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-progress-horizontal@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-checked-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-checked@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-indicator-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-indicator@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/toolseparator-separator-vertical.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/toolseparator-separator-vertical@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/bluetooth.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/cart.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/cloud.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/favorite.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/filter.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/folder.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/message.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/music.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/next.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/pause.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/power.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/previous.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/repeat.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/save.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/settings.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/shuffle.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/stop.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/bluetooth.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/cart.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/cloud.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/favorite.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/filter.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/folder.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/grid.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/message.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/music.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/next.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/pause.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/power.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/previous.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/repeat.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/save.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/settings.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/shuffle.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/stop.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/images/album-cover.jpg
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/applicationwindow-background.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-checked-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-checked-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-checked@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-disabled@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-pressed@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-open.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-open@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-pressed@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-open.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-open@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-popup.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-popup@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-handle-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-handle-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-handle@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/frame-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/frame-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-checked@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-disabled@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-pressed@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-checked-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-checked-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-checked.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-checked@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-disabled@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive-pressed.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive-pressed@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-horizontal-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-horizontal-disabled@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-horizontal@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-vertical-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-vertical-disabled@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-vertical.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-vertical@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle-disabled.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle-disabled@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle-hovered.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle-hovered@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-horizontal.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-horizontal@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-vertical-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-vertical-disabled@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-vertical.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-vertical@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/textfield-background-disabled.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/textfield-background-disabled@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/textfield-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/textfield-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbar-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbar-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-checked-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-checked-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-checked.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-checked@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-hovered.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-hovered@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-pressed.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-pressed@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/tooltip-background.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/tooltip-background@2x.9.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/sidepanel/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/sidepanel/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/sidepanel/images/qt-logo.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/sidepanel/images/qt-logo@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/sidepanel/images/qt-logo@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/sidepanel/images/qt-logo@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/texteditor/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/texteditor/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/texteditor/images/qt-logo.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/alarms.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/fitness.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/navigation.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/notifications.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/settings.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/weather.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/worldclock.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/alarms.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/fitness.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/navigation.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/notifications.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/settings.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/weather.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/worldclock.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/back.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/back@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/back@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/back@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/background-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/background-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/home.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/home@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/home@3x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/images/home@4x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-running-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-running-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-running-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-running-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-walking-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-walking-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-walking-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-walking-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/end.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/end@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/leftturn-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/leftturn-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/leftturn-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/leftturn-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/marker.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/navigation-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/navigation-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/navigation-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/navigation-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/rightturn-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/rightturn-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/rightturn-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/rightturn-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/start.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/start@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/straight-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/straight-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/straight-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/straight-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/uturn.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/uturn@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarf-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarf-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarf-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarf-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarm-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarm-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarm-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarm-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/missedcall-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/missedcall-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/missedcall-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/missedcall-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/bluetooth-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/bluetooth-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/bluetooth-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/bluetooth-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/brightness-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/brightness-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/brightness-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/brightness-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-white.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-white@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/theme-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/theme-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/theme-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/theme-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/wifi-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/wifi-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/wifi-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/wifi-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/humidity-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/humidity-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/humidity-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/humidity-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/pressure-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/pressure-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/pressure-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/pressure-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunrise-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunrise-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunrise-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunrise-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunset-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunset-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunset-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunset-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/temperature-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/temperature-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/temperature-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/temperature-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/wind-dark.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/wind-dark@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/wind-light.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/wind-light@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/center.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/center@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/clock-night.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/clock-night@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/clock.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/second.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/second@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdaydial.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdaydial@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdayhour.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdayhour@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdayminute.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdayminute@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnightdial.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnightdial@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnighthour.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnighthour@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnightminute.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnightminute@2x.png
  • usr/share/doc/qt/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissseconds.png
  • usr/share/doc/qt/qtquickcontrols/qml-palette.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-abstractbutton-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-abstractbutton.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-action-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-action.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-actiongroup-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-actiongroup.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-applicationwindow-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-applicationwindow-obsolete.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-applicationwindow.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-busyindicator-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-busyindicator.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-button-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-button.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-buttongroup-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-buttongroup.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-checkbox-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-checkbox.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-checkdelegate-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-checkdelegate.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-combobox-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-combobox.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-container-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-container-obsolete.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-container.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-control-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-control.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-delaybutton-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-delaybutton.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dial-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dial.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dialog-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dialog.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dialogbuttonbox-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dialogbuttonbox.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-drawer-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-drawer.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-frame-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-frame.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-groupbox-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-groupbox.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-itemdelegate-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-itemdelegate.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-label-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-label.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menu-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menu-obsolete.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menu.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menubar-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menubar.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menubaritem-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menubaritem.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menuitem-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menuitem.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menuseparator-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menuseparator.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-overlay-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-overlay.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-page-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-page.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-pageindicator-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-pageindicator.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-pane-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-pane.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-popup-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-popup.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-progressbar-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-progressbar.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-radiobutton-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-radiobutton.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-radiodelegate-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-radiodelegate.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-rangeslider-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-rangeslider.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-roundbutton-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-roundbutton.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollbar-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollbar.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollindicator-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollindicator.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollview-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollview.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-slider-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-slider.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-spinbox-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-spinbox.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-stackview-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-stackview.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-swipedelegate-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-swipedelegate.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-swipeview-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-swipeview.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-switch-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-switch.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-switchdelegate-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-switchdelegate.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tabbar-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tabbar.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tabbutton-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tabbutton.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-textarea-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-textarea.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-textfield-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-textfield.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolbar-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolbar.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolbutton-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolbutton.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolseparator-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolseparator.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tooltip-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tooltip.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tumbler-members.html
  • usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tumbler.html
  • usr/share/doc/qt/qtquickcontrols/qquickstyle-members.html
  • usr/share/doc/qt/qtquickcontrols/qquickstyle.html
  • usr/share/doc/qt/qtquickcontrols/qtquick-controls2-qmlmodule.html
  • usr/share/doc/qt/qtquickcontrols/qtquick-templates2-qmlmodule.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-attribution-shadow-angular-material.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter1-settingup-chapter1-settingup-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter1-settingup-main-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter1-settingup-main-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter1-settingup-qml-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter2-lists-chapter2-lists-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter2-lists-main-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter2-lists-qml-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-chapter3-navigation-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-contactpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-conversationpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-main-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-qml-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-chapter4-models-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-contactpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-conversationpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-main-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-qml-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-sqlcontactmodel-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-sqlcontactmodel-h.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-sqlconversationmodel-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-sqlconversationmodel-h.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-chapter5-styling-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-chattoolbar-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-contactpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-conversationpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-main-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-material-chattoolbar-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-qml-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-qtquickcontrols2-conf.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-sqlcontactmodel-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-sqlcontactmodel-h.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-sqlconversationmodel-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-sqlconversationmodel-h.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-chattutorial-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-shared-shared-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-contactdelegate-ui-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-contactdialog-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-contactform-ui-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-contactlist-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-contactlist-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-contactmodel-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-contactmodel-h.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-contactview-ui-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-designer-backend-contactmodel-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-designer-backend-qmldir.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-main-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-sectiondelegate-ui-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-flat-button-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-flat-checkbox-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-flat-switch-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-flatstyle-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-flatstyle-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-imports-theme-qmldir.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-imports-theme-theme-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-main-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-mainform-ui-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-qtquickcontrols2-conf.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-gallery-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-gallery-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-gallery-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-busyindicatorpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-buttonpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-checkboxpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-comboboxpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-delaybuttonpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-delegatepage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-dialogpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-dialpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-framepage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-groupboxpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-pageindicatorpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-progressbarpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-radiobuttonpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-rangesliderpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-scrollablepage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-scrollbarpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-scrollindicatorpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-sliderpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-spinboxpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-stackviewpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-swipeviewpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-switchpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-tabbarpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-textareapage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-textfieldpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-tooltippage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-pages-tumblerpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-qtquickcontrols2-conf.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-automotive-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-automotive-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-icons-automotive-icons-svg.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-icons-icons-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-imagine-assets-imagine-assets-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-automotive-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-customglow-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-featurebutton-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-glowinglabel-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-qml-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-qtquickcontrols2-conf.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-icons-icons-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-icons-musicplayer-icons-svg.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-imagine-assets-imagine-assets-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-musicplayer-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-musicplayer-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-musicplayer-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-qtquickcontrols2-conf.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-index.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-sidepanel-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-sidepanel-sidepanel-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-sidepanel-sidepanel-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-sidepanel-sidepanel-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-swipetoremove-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-swipetoremove-swipetoremove-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-swipetoremove-swipetoremove-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-swipetoremove-swipetoremove-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-documenthandler-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-documenthandler-h.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-qml-texteditor-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-qml-touch-texteditor-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-qtquickcontrols2-conf.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-texteditor-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-texteditor-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-texteditor-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-example.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-alarms-alarmspage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-demomode-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-demomodeindicator-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-fitness-fitness-js.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-fitness-fitnesspage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-launcherpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-navibutton-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-navigation-navigation-js.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-navigation-navigationpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-navigation-routeelement-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-notifications-notifications-js.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-notifications-notificationspage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-settings-images-demo-mode-svg.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-settings-images-theme-svg.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-settings-settingspage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-style-pageindicator-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-style-qmldir.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-style-slider-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-style-switch-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-style-uistyle-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-swipeviewpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-weather-weather-js.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-weather-weatherpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-worldclock-clock-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-qml-worldclock-worldclockpage-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-wearable-cpp.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-wearable-pro.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-wearable-qml.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-wearable-qrc.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols.index
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols.qhp
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols.qhp.sha1
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols.tags
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-buttons.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-configuration.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-containers.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-customize.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-default.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-delegates.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-deployment.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-differences.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-environment.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-examples.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-fileselectors.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-focus.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-fusion.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-gettingstarted.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-guidelines.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-highdpi.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-icons.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-imagine.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-indicators.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-input.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-material.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-menus.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-module.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-navigation.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-popups.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-separators.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-styles.html
  • usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-universal.html
  • usr/share/doc/qt/qtquickcontrols/qtquicktemplates2-index.html
  • usr/share/doc/qt/qtquickcontrols/style/
  • usr/share/doc/qt/qtquickcontrols/style/offline-simple.css
  • usr/share/doc/qt/qtquickcontrols/style/offline.css
  • usr/share/doc/qt/qtquickcontrols1.qch
  • usr/share/doc/qt/qtquickcontrols1/
  • usr/share/doc/qt/qtquickcontrols1/applicationwindow.html
  • usr/share/doc/qt/qtquickcontrols1/applicationwindowstyling.html
  • usr/share/doc/qt/qtquickcontrols1/controls.html
  • usr/share/doc/qt/qtquickcontrols1/controlsstyling.html
  • usr/share/doc/qt/qtquickcontrols1/examples-manifest.xml
  • usr/share/doc/qt/qtquickcontrols1/images/
  • usr/share/doc/qt/qtquickcontrols1/images/applicationwindow.png
  • usr/share/doc/qt/qtquickcontrols1/images/arrow_bc.png
  • usr/share/doc/qt/qtquickcontrols1/images/bgrContent.png
  • usr/share/doc/qt/qtquickcontrols1/images/btn_next.png
  • usr/share/doc/qt/qtquickcontrols1/images/btn_prev.png
  • usr/share/doc/qt/qtquickcontrols1/images/bullet_dn.png
  • usr/share/doc/qt/qtquickcontrols1/images/bullet_sq.png
  • usr/share/doc/qt/qtquickcontrols1/images/busyindicator.png
  • usr/share/doc/qt/qtquickcontrols1/images/button.png
  • usr/share/doc/qt/qtquickcontrols1/images/calendar.png
  • usr/share/doc/qt/qtquickcontrols1/images/calendarstyle-components-week-numbers.png
  • usr/share/doc/qt/qtquickcontrols1/images/checkbox.png
  • usr/share/doc/qt/qtquickcontrols1/images/circulargauge-angles.png
  • usr/share/doc/qt/qtquickcontrols1/images/circulargauge-needle-example-2.png
  • usr/share/doc/qt/qtquickcontrols1/images/circulargauge-needle.png
  • usr/share/doc/qt/qtquickcontrols1/images/circulargauge-reversed.png
  • usr/share/doc/qt/qtquickcontrols1/images/circulargauge-tickmark-indices-values.png
  • usr/share/doc/qt/qtquickcontrols1/images/combobox.png
  • usr/share/doc/qt/qtquickcontrols1/images/gauge-minorTickmark-example.png
  • usr/share/doc/qt/qtquickcontrols1/images/gauge-temperature.png
  • usr/share/doc/qt/qtquickcontrols1/images/gauge-tickmark-example.png
  • usr/share/doc/qt/qtquickcontrols1/images/groupbox.png
  • usr/share/doc/qt/qtquickcontrols1/images/home.png
  • usr/share/doc/qt/qtquickcontrols1/images/ico_note.png
  • usr/share/doc/qt/qtquickcontrols1/images/ico_note_attention.png
  • usr/share/doc/qt/qtquickcontrols1/images/ico_out.png
  • usr/share/doc/qt/qtquickcontrols1/images/label.png
  • usr/share/doc/qt/qtquickcontrols1/images/logo.png
  • usr/share/doc/qt/qtquickcontrols1/images/menu.png
  • usr/share/doc/qt/qtquickcontrols1/images/menubar-action.png
  • usr/share/doc/qt/qtquickcontrols1/images/menubar.png
  • usr/share/doc/qt/qtquickcontrols1/images/piemenu-menuitem-example.png
  • usr/share/doc/qt/qtquickcontrols1/images/progressbar.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-calendar.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-filesystembrowser.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-gallery-android-dark.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-gallery-android.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-gallery-osx.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-styles.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-tableview.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-text.png
  • usr/share/doc/qt/qtquickcontrols1/images/qtquick